CAZyme Information: MGYG000003255_00228

Basic Information

• Species: Muribaculum sp002473395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp002473395
• CAZyme ID: MGYG000003255_00228
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
461		52476.77	5.9136

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003255	2196175	MAG	United States	North America

• Gene Location: Start: 5531; End: 6916 Strand: -

Full Sequence      

MKKLLLMLTIFLSAATISQAKGLHELQQEFVNLKFGLFIHFGMGTYLDEDWADPEQPATL
FNPQKLNCDQWADGAQNAGMSFGCISVKHHNGFCMWNTATTPYSVMNSGIARDVLKEFTD
AMHRRNMKVMFHFSILDLREKILPRHIKPSDTDFIKAQLRELLTGYGPVTALMIDGWDAP
WGRISYDDISFEDIYRYVKSIQPECLVMDLNGAKYPGDALFYSDLKTYEQGAGQRIDRSK
AWLPSMSCDHLQPTWFWKSWFPSMELPSAESMVANNIIPKNEAGCTFIMNVAPNTDGLLD
DNALQRLAEIGRLWKNNLKGIEIEEAPEPIISANIAKHRHATGSWSYDCEIHDFANDDNF
RSCWVSNRAVKVPWLMIDLETEQEFNTVAITDNSECTLKAYALEYRKNGEWHKVFSGDAP
TARQVKIHRFNKVKGDAVRLTITGYNGEVAIAEIGVYNEKR

Enzyme Prediction     

No EC number prediction in MGYG000003255_00228.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	18	321	3.1e-63	0.8988439306358381

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01120	Alpha_L_fucos	5.25e-37	24	314	16	327	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	3.35e-36	24	321	17	337	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
COG3669	AfuC	4.59e-26	25	457	13	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam00754	F5_F8_type_C	1.02e-11	341	454	2	124	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT41826.1	9.58e-191	1	461	1	463
ALJ40132.1	1.36e-190	1	461	1	463
QUT69664.1	1.36e-190	1	461	1	463
QQA10757.1	1.36e-190	1	461	1	463
QMW89201.1	1.36e-190	1	461	1	463

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K9H_A	3.88e-31	25	457	41	463	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
6GN6_A	7.19e-27	28	317	32	347	Alpha-L-fucosidaseisoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_B Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_C Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_D Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_E Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_F Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus]
3UES_A	3.26e-26	38	444	34	463	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UET_A	3.66e-25	38	444	34	463	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3MO4_A	2.26e-24	38	444	36	465	Thecrystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3MO4_B The crystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	4.83e-32	37	460	52	480	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	6.36e-27	34	459	51	478	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P10901	4.56e-09	32	321	39	360	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
Q99LJ1	7.87e-09	30	321	39	355	Tissue alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca1 PE=1 SV=1
Q6AYS4	1.06e-08	30	321	42	359	Plasma alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000257	0.999095	0.000148	0.000164	0.000149	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003255_00228.