CAZyme Information: MGYG000003255_01789

Basic Information

• Species: Muribaculum sp002473395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp002473395
• CAZyme ID: MGYG000003255_01789
• CAZy Family: PL11
• CAZyme Description: Rhamnogalacturonan endolyase YesW

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
245		27733.19	4.8465

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003255	2196175	MAG	United States	North America

• Gene Location: Start: 132; End: 869 Strand: +

Full Sequence      

MTVDNDGTGLYSTGMYHGDAIHLLSDVNNEKYYVWCCHENRKDGSSLRDAATGEVIFQFP
SNKDIGRCMAADIDPNHKGVEVWSPNSGGVRSFTGELISPKMEFQTEVSFKVPVNMAVWW
DGDLLREMLDKNVISKYNWKTGVCDPLLTMEGCMWNNGTKANPCLQADIIGDWREEVLMR
TADNQNLRLYVSPIPTDYRFHTFCEDPTYRVSVANENIAYNQPAEPGFYFGPDLKGQTFR
GTKVK

Enzyme Prediction     

No EC number prediction in MGYG000003255_01789.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL11	1	236	3.7e-90	0.39451114922813035

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10318	RGL11	7.04e-108	1	228	343	564	Rhamnogalacturonan lyase of the polysaccharide lyase family 11. The rhamnogalacturonan lyase of the polysaccharide lyase family 11 (RGL11) cleaves glycoside bonds in polygalacturonan as well as RG (rhamnogalacturonan) type-I through a beta-elimination reaction. Functionally characterized members of this family, YesW and YesX from Bacillus subtilis, cleave glycoside bonds between rhamnose and galacturonic acid residues in the RG-I region of plant cell wall pectin. YesW and YesX work synergistically, with YesW cleaving the glycoside bond of the RG chain endolytically, and YesX converting the resultant oligosaccharides through an exotype reaction. This domain is sometimes found in architectures with non-catalytic carbohydrate-binding modules (CBMs). There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain through a beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD34465.1	1.01e-147	1	245	374	619
ALJ43460.1	6.90e-117	2	244	374	610
BCA48720.1	6.90e-117	2	244	374	610
QMW86518.1	6.90e-117	2	244	374	610
QQA07688.1	6.90e-117	2	244	374	610

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z8R_A	3.66e-68	1	237	346	575	Crystalstructure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8R_B Crystal structure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8S_A Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2Z8S_B Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2ZUX_A Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis],2ZUX_B Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis]
4CAG_A	2.96e-62	1	235	353	580	Bacilluslicheniformis Rhamnogalacturonan Lyase PL11 [Bacillus licheniformis]
2ZUY_A	2.61e-59	1	235	350	594	Crystalstructure of exotype rhamnogalacturonan lyase YesX [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31526	3.51e-67	1	237	383	612	Rhamnogalacturonan endolyase YesW OS=Bacillus subtilis (strain 168) OX=224308 GN=yesW PE=1 SV=1
O31527	1.26e-58	1	235	350	594	Rhamnogalacturonan exolyase YesX OS=Bacillus subtilis (strain 168) OX=224308 GN=yesX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003255_01789.