CAZyme Information: MGYG000003282_00236

Basic Information

• Species: Coprobacter sp900545915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter sp900545915
• CAZyme ID: MGYG000003282_00236
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
464		52802.78	6.6774

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003282	3080391	MAG	United States	North America

• Gene Location: Start: 116147; End: 117541 Strand: -

Full Sequence      

MKKCIYILCSLNLLFNLGCTIRNATNKLIKVPIPERAEGQADVLELTAPKLDTVRVGFIG
LGMRGISAVERFIHIPGTKIVALCDIRPECVDKSQKVLIDAGLPKAVTYTGNEEAWKKLC
ERNDIDLVYIATDWKHHAPMAIYSMEQGKHAAVEVPAAMNMEEIWDIINTSEKTRKHCIQ
LENCVYDFFELTTLNMAQQGVFGDILHVEGAYIHNLEEFWSLYWNNWRLDYNRNHRGDVY
PTHGMGPACQLLDMHRGDKMNILVAMDTKAFAAPAYIERESGEKVENFKNGDHTMTMIRT
EKGKTIHIQHNVVSPRPYNRMYQLTGTKGFANKYPVEGYVLESGQILSGVVPDHEDFSGH
SFVSDEVKNTLMQKYKHPIQIELERVAKKVGGHGGMDYIMDYRLIYCLRNGLPLDMDVYD
LAEWCCLIPLTEISIENNSAPVEVPDFTRGGWNKVKGFRHAFVR

Enzyme Prediction     

No EC number prediction in MGYG000003282_00236.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	50	454	2.1e-165	0.9924812030075187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	2.37e-18	53	355	3	281	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	6.24e-09	54	179	1	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
COG4091	COG4091	6.09e-04	54	162	18	135	Predicted homoserine dehydrogenase, contains C-terminal SAF domain [Amino acid transport and metabolism].
PRK11579	PRK11579	0.001	52	209	3	149	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO51930.1	2.50e-265	28	464	19	455
AZS31970.1	2.27e-261	28	464	19	455
BCI63291.1	4.75e-256	13	462	14	464
AUI45417.1	5.25e-253	25	464	25	464
QCQ53891.1	1.06e-252	25	464	25	464

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	2.07e-91	32	452	21	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	4.70e-71	54	456	21	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E82_A	2.49e-07	52	212	6	155	Crystalstructure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5LGZ0	2.01e-251	25	464	25	464	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1
P0C863	2.01e-251	25	464	25	464	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1
A6KX96	1.23e-249	29	464	36	471	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1
Q89ZX8	1.66e-246	29	463	32	466	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
Q7MWF4	1.64e-244	29	463	33	467	Glycosyl hydrolase family 109 protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=PG_0664 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000002	0.000061	0.999989	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003282_00236.