CAZyme Information: MGYG000003332_00207

Basic Information

• Species: Prevotella sp900550035
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900550035
• CAZyme ID: MGYG000003332_00207
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
449		51521.67	7.2534

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003332	2583592	MAG	China	Asia

• Gene Location: Start: 136; End: 1485 Strand: +

Full Sequence      

MKIKRILCSMLCAAAMTGAVAQTAIPGETEEQKDKRMEWFDHAKLGIFIHYGIYAVNGVS
ESWSFYNSYLPYEQYMSQCNGFTAKNYDPKAWLDLIKESGAKYAVLTTKHHDGVALWNTK
YSDLNTIKATAAKRDIVTPFVKEVRKHGLKLGLYYSLIDWSHPDYPNFTRTETRYNVKDD
SARWQKFLKFDFNQLDELNQYKPDLYWFDGDWEQDAETWNAKGMSEFLRKANKNVIINSR
IQGYGDYATPEQGVPVVRPADKHWELCMTMNDSWGYQHADTNYKSPYILLRTFVDCLSMG
GNMLLDIGPKEDGTIPEEQVAILKEFGRWTKKHKEAIYDTRAGIPAEHFQGYTTLNKAGD
ILYLYLPYKPNGPIEVKGVMNKVNRVWVVGDGEIIQSKVHNKNYWSEVPGNLYINVPERS
LDPMITVVAVLLDGPIKLYRGAGKVIESN

Enzyme Prediction     

No EC number prediction in MGYG000003332_00207.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	27	339	6.2e-100	0.9075144508670521

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	1.06e-133	27	378	8	383	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	3.03e-123	29	335	9	333	Alpha-L-fucosidase.
COG3669	AfuC	7.41e-43	50	342	1	324	Alpha-L-fucosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24790.1	5.51e-266	20	449	21	449
QCQ40555.1	3.18e-265	18	449	19	449
AKA50907.1	4.51e-265	18	449	19	449
ANQ59545.1	4.51e-265	18	449	19	449
CAH06554.1	4.51e-265	18	449	19	449

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GN6_A	1.53e-80	33	433	27	444	Alpha-L-fucosidaseisoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_B Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_C Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_D Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_E Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_F Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus]
2WVS_A	8.78e-53	27	420	11	428	Crystalstructure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_B Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_C Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_D Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482]
2WVV_B	1.02e-52	27	442	7	448	Crystalstructure of an alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6HZY_A	1.73e-52	19	442	21	473	Crystalstructure of a bacterial fucosidase with inhibitor FucPUG [Bacteroides thetaiotaomicron VPI-5482],6HZY_B Crystal structure of a bacterial fucosidase with inhibitor FucPUG [Bacteroides thetaiotaomicron VPI-5482]
2WVV_A	1.99e-52	27	442	7	448	Crystalstructure of an alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2WVV_C Crystal structure of an alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2WVV_D Crystal structure of an alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4J27_A Crystal structure of a gh29 alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in a novel crystal form [Bacteroides thetaiotaomicron VPI-5482],4J27_B Crystal structure of a gh29 alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in a novel crystal form [Bacteroides thetaiotaomicron VPI-5482],4J28_A Crystal structure of a gh29 alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in complex with a 5-membered iminocyclitol inhibitor [Bacteroides thetaiotaomicron VPI-5482],4J28_B Crystal structure of a gh29 alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in complex with a 5-membered iminocyclitol inhibitor [Bacteroides thetaiotaomicron VPI-5482],4JFS_A Crystal structure of a bacterial fucosidase with iminosugar inhibitor 4-epi-(+)-Codonopsinine [Bacteroides thetaiotaomicron VPI-5482],4JFS_B Crystal structure of a bacterial fucosidase with iminosugar inhibitor 4-epi-(+)-Codonopsinine [Bacteroides thetaiotaomicron VPI-5482],4JFT_A Crystal structure of a bacterial fucosidase with iminosugar inhibitor N-desmethyl-4-epi-(+)-Codonopsinine [Bacteroides thetaiotaomicron VPI-5482],4JFT_B Crystal structure of a bacterial fucosidase with iminosugar inhibitor N-desmethyl-4-epi-(+)-Codonopsinine [Bacteroides thetaiotaomicron VPI-5482],4JFU_A Crystal structure of a bacterial fucosidase with iminosugar inhibitor [Bacteroides thetaiotaomicron VPI-5482],4JFU_B Crystal structure of a bacterial fucosidase with iminosugar inhibitor [Bacteroides thetaiotaomicron VPI-5482],4JFV_A Crystal structure of a bacterial fucosidase with iminosugar inhibitor (2S,3S,4R,5S)-2-[N-(methylferrocene)]aminoethyl-5-methylpyrrolidine-3,4-diol [Bacteroides thetaiotaomicron VPI-5482],4JFV_B Crystal structure of a bacterial fucosidase with iminosugar inhibitor (2S,3S,4R,5S)-2-[N-(methylferrocene)]aminoethyl-5-methylpyrrolidine-3,4-diol [Bacteroides thetaiotaomicron VPI-5482],4JFV_C Crystal structure of a bacterial fucosidase with iminosugar inhibitor (2S,3S,4R,5S)-2-[N-(methylferrocene)]aminoethyl-5-methylpyrrolidine-3,4-diol [Bacteroides thetaiotaomicron VPI-5482],4JFV_D Crystal structure of a bacterial fucosidase with iminosugar inhibitor (2S,3S,4R,5S)-2-[N-(methylferrocene)]aminoethyl-5-methylpyrrolidine-3,4-diol [Bacteroides thetaiotaomicron VPI-5482],4JFW_A Crystal structure of a bacterial fucosidase with iminosugar inhibitor (2S,3S,4R,5S)-2-[N-(propylferrocene)]aminoethyl-5-methylpyrrolidine-3,4-diol [Bacteroides thetaiotaomicron VPI-5482],4JFW_B Crystal structure of a bacterial fucosidase with iminosugar inhibitor (2S,3S,4R,5S)-2-[N-(propylferrocene)]aminoethyl-5-methylpyrrolidine-3,4-diol [Bacteroides thetaiotaomicron VPI-5482],4JFW_C Crystal structure of a bacterial fucosidase with iminosugar inhibitor (2S,3S,4R,5S)-2-[N-(propylferrocene)]aminoethyl-5-methylpyrrolidine-3,4-diol [Bacteroides thetaiotaomicron VPI-5482],4JFW_D Crystal structure of a bacterial fucosidase with iminosugar inhibitor (2S,3S,4R,5S)-2-[N-(propylferrocene)]aminoethyl-5-methylpyrrolidine-3,4-diol [Bacteroides thetaiotaomicron VPI-5482],4JL1_A Crystal structure of a bacterial fucosidase with a multivalent iminocyclitol inhibitor [Bacteroides thetaiotaomicron VPI-5482],4JL1_B Crystal structure of a bacterial fucosidase with a multivalent iminocyclitol inhibitor [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q99KR8	3.96e-48	29	340	31	364	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1
P48300	1.16e-46	38	421	51	448	Tissue alpha-L-fucosidase OS=Canis lupus familiaris OX=9615 GN=FUCA1 PE=2 SV=1
Q60HF8	2.38e-46	39	418	54	448	Tissue alpha-L-fucosidase OS=Macaca fascicularis OX=9541 GN=FUCA1 PE=2 SV=1
Q5RFI5	3.12e-46	29	424	35	451	Plasma alpha-L-fucosidase OS=Pongo abelii OX=9601 GN=FUCA2 PE=2 SV=1
Q99LJ1	4.69e-46	39	377	38	397	Tissue alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.061303	0.927490	0.005974	0.002140	0.001301	0.001762

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003332_00207.