CAZyme Information: MGYG000003355_00349

Basic Information

• Species: Lachnoclostridium phytofermentans_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium; Lachnoclostridium phytofermentans_A
• CAZyme ID: MGYG000003355_00349
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
648		73061.89	4.5567

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003355	5194070	MAG	China	Asia

• Gene Location: Start: 6450; End: 8396 Strand: -

Full Sequence      

MRIWKKIVAASLCAALVFTGLGGSRLTVKAEEETVSTSQAYVNAMNPGWNLGNTFDGFDT
GGDRGEESWGNPKVTKELIATIKEQGFNSIRIPFTSVMRTGEAPDYKLDEVFLARYAEVV
NWALEEGLYVMINLHHDSWNWAAAIGADWDGGASIVRYKAIWTQLADYFKDYPDKLCFES
LNEPQFWSGDEARQLEINDEVNQAFYDIVRNSGGKNGTRMLVLPTLNTNDSQSRCDALYS
MMKELKDENIIATFHYYGYWPFSTNIAGTTTMDATVVKELEAAFNRVYNTFTKNGIGVIC
GEYGLLGFDKSLNAIEHGEVLKYFDYINYYSNKTNIPLMLWDNGQHMSRTEYVWGDQSLY
DTIKASLTGRSSYTETDRVFLTEDSLNKNILLNLTLNGNKLKEVYYGDELLTNAKDYVST
PNKFILKSTFVKSIVSGEYGEVAKLRLVFSDGADWMLYLNYCKAPVVLEGSGDKSGYVIP
VEFNGNVLSTLEAVKEDGSGVGPQNWTSYKEYDYAFSVDYKAGTVKFTDKFFSEAEDSTV
IVTLHFQNGTTAKTQFTIEGDKVTFAKDVNTGVDDEETEVTEPEKEDTEKENPEKEEAYT
VQKGDSLWKIAKKLLGKGSEWTKLYQWNKDSIKNPDFIQIGQKLVVKK

Enzyme Prediction     

No EC number prediction in MGYG000003355_00349.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	66	345	5.3e-82	0.9927536231884058
CBM46	374	458	4.5e-17	0.9770114942528736

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.53e-43	56	346	4	271	Cellulase (glycosyl hydrolase family 5).
pfam18448	CBM46	4.36e-29	464	564	2	103	Carbohydrate binding domain. Carbohydrate active enzymes (CAZYmes) that target recalcitrant polysaccharides are modular enzymes containing noncatalytic carbohydrate-binding modules (CBMs) that direct enzymes to their cognate substrate, thus potentiating catalysis. The structure of Bacillus halodurans endo-beta-1,4-glucanase B (Cel5B) reveals that CBM46 is tightly associated with the catalytic module and, dependent on the glucan presented to the enzyme, can contribute directly to substrate binding or play a targeting role in directing the enzyme to regions of the plant cell wall rich in the polysaccharide hydrolyzed by the enzyme. The CBM46 domain displays a classic beta-sandwich jelly roll fold. Against beta-1,3-1,4-glucans CBM46 domain participates in productive substrate binding and thus plays a direct role in the hydrolytic activity of the enzyme.
COG2730	BglC	1.26e-28	35	355	41	371	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
PRK11198	PRK11198	2.56e-15	547	644	38	143	LysM domain/BON superfamily protein; Provisional
cd00118	LysM	5.23e-11	599	646	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS96699.1	4.44e-256	4	563	4	563
BCN31364.1	1.23e-249	1	636	1	616
ADL52313.1	3.86e-228	1	564	1	567
BAV13065.1	3.86e-228	1	564	1	567
ACZ98603.1	1.33e-218	1	563	1	560

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4V2X_A	5.45e-157	28	564	46	582	ChainA, Endo-beta-1,4-glucanase (cellulase B) [Halalkalibacterium halodurans]
5XRC_A	3.40e-149	22	549	26	552	ATrimodular GH5_4 Subfamily Endoglucanase Structure with Large Unit Cell [Bacillus sp. BG-CS10],5XRC_B A Trimodular GH5_4 Subfamily Endoglucanase Structure with Large Unit Cell [Bacillus sp. BG-CS10],5XRC_C A Trimodular GH5_4 Subfamily Endoglucanase Structure with Large Unit Cell [Bacillus sp. BG-CS10]
5E0C_A	4.13e-149	39	549	11	519	StructuralInsight of a Trimodular Halophilic Cellulase with a Family 46 Carbohydrate-Binding Module [Bacillus sp. BG-CS10]
5E09_A	1.05e-143	39	549	11	519	StructuralInsight of a Trimodular Halophilic Cellulase with a Family 46 Carbohydrate-Binding Module [Bacillus sp. BG-CS10]
4YZP_A	5.29e-67	23	516	9	494	Crystalstructure of a tri-modular GH5 (subfamily 4) endo-beta-1, 4-glucanase from Bacillus licheniformis [Bacillus licheniformis],4YZT_A Crystal structure of a tri-modular GH5 (subfamily 4) endo-beta-1, 4-glucanase from Bacillus licheniformis complexed with cellotetraose [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23550	1.79e-152	36	549	35	547	Endoglucanase B OS=Paenibacillus lautus OX=1401 GN=celB PE=3 SV=1
P28623	8.30e-48	38	355	43	350	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
P23660	2.11e-46	42	351	31	338	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
P28621	3.20e-46	37	355	41	352	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
P10477	3.22e-45	42	346	61	354	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000222	0.999070	0.000224	0.000171	0.000155	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003355_00349.