CAZyme Information: MGYG000003371.1_02213

Basic Information

• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Sphingomonadales; Sphingomonadaceae; Sphingomonas
• CAZyme ID: MGYG000003371.1_02213
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
141		14446.53	4.6755

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003371.1	3702384	MAG	United States	North America

• Gene Location: Start: 539; End: 964 Strand: -

Full Sequence      

MKLLLLGEGAARAALDAQIAALGLGDRVTMPGHAGDPLPALRGAAVAVLTSDYEGVPGVL
REALSVGTPVVSTESSVAVREIVHAPGLGTVIAREDGDALVAALDHWLAPDAVRPAPVTA
TGDPIADYLALFDRMVDSHRR

Enzyme Prediction     

No EC number prediction in MGYG000003371.1_02213.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	2	114	5.7e-19	0.70625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03811	GT4_GT28_WabH-like	3.98e-21	2	106	221	324	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03820	GT4_AmsD-like	1.90e-18	2	105	214	317	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.
pfam00534	Glycos_transf_1	1.42e-15	2	108	35	142	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
pfam13692	Glyco_trans_1_4	7.55e-15	2	109	35	137	Glycosyl transferases group 1.
COG0438	RfaB	3.72e-14	2	116	232	348	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQR74825.1	3.57e-65	1	138	224	361
ATY33265.1	1.84e-63	1	136	224	359
AJP74593.1	2.05e-63	3	141	227	365
QNA85995.1	2.02e-52	1	137	224	361
QNQ08790.1	2.60e-48	3	136	226	360

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003371.1_02213.