CAZyme Information: MGYG000003404_00162

Basic Information

• Species: Lactococcus hircilactis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus; Lactococcus hircilactis
• CAZyme ID: MGYG000003404_00162
• CAZy Family: GH65
• CAZyme Description: Maltose phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
288		33462.01	6.3959

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003404	1333590	MAG	United States	North America

• Gene Location: Start: 1127; End: 1993 Strand: -

Full Sequence      

MHYSARNDKYMIHGVTGPNEYENNINNNWYTNTLASWVLKYTSESLSKYPRPDLEVSRAE
LEKWAEIIEKMYYPKDEALGIFVQHDGYLDKDLTPVAKLDPKNLPLNQNWSWDRVLRSPY
IKQADVLQGIYFFGDQYTLEEKRRNFNFYEPLTVHESSLSPSIHAILAAELGMGEKAVEM
YERTARLDLDNYNNDTKDGLHITSMTGSWLAIVQGFAQMKTWNGQLSFAPFLPKAWTGYV
FHINYRGRLLKISVRKQVEIELLKGKPLEIEVYGKQFVLEGQKTIDIS

Enzyme Prediction     

EC	2.4.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	2	222	7.6e-84	0.5967741935483871

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13807	PRK13807	0.0	2	287	467	756	maltose phosphorylase; Provisional
COG1554	ATH1	1.54e-133	2	287	476	768	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
pfam03632	Glyco_hydro_65m	4.15e-103	2	226	158	387	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
pfam03633	Glyco_hydro_65C	4.99e-18	230	278	1	50	Glycosyl hydrolase family 65, C-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The C-terminal domain forms a two layered jelly roll motif. This domain is situated at the base of the catalytic domain, however its function remains unknown.
COG3459	COG3459	3.12e-04	161	276	898	1041	Cellobiose phosphorylase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDK71657.1	1.01e-175	1	288	466	753
AYG00722.1	2.03e-175	1	280	466	745
QRZ11196.1	1.63e-174	1	279	466	744
QSE76390.1	4.25e-172	1	279	466	744
QTP69092.1	3.22e-171	1	280	465	743

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H54_A	7.81e-119	1	274	468	745	ChainA, Maltose Phosphorylase [Levilactobacillus brevis],1H54_B Chain B, Maltose Phosphorylase [Levilactobacillus brevis]
3WIQ_A	3.44e-41	3	279	466	756	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
4KTP_A	1.48e-39	3	283	458	756	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	3.77e-39	3	283	458	756	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E6ENP7	5.77e-138	1	287	488	776	Maltose phosphorylase OS=Enterococcus faecalis (strain TX4000 / JH2-2) OX=749493 GN=malP PE=1 SV=1
O06993	6.37e-131	1	282	464	749	Maltose phosphorylase OS=Bacillus subtilis (strain 168) OX=224308 GN=mdxK PE=3 SV=1
Q8L164	4.78e-59	6	280	484	769	Alpha,alpha-trehalose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=treP PE=1 SV=1
Q8GRC3	1.49e-55	9	288	468	758	Alpha,alpha-trehalose phosphorylase OS=Geobacillus stearothermophilus OX=1422 GN=treP PE=1 SV=1
Q8L163	2.03e-47	3	280	484	775	Kojibiose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=kojP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003404_00162.