CAZyme Information: MGYG000003404_00438

Basic Information

• Species: Lactococcus hircilactis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus; Lactococcus hircilactis
• CAZyme ID: MGYG000003404_00438
• CAZy Family: GH92
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
252		28195.81	5.7032

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003404	1333590	MAG	United States	North America

• Gene Location: Start: 1307; End: 2065 Strand: -

Full Sequence      

MRAKDQLGHFRADFLSTRWGRDYAEGSAWQTSWSVLHDFSGLVLLHGGAESFEKKLIELC
NQRPDFNVEGYGFEIHEMSEMAALEFGQVAISNQPSFHYPYLFHYIGKPWMGTALLKNLM
LETFNDGTKGYPGDEDNGTMAAWYVFSSLGFYPITAGSGEYVIGLPLWDKATLHLSSGNT
LTIEATPNQAQQLYVNTVKMDHVPVKESFLNHSQLMAGGVLHFDLGIVPNPNCFSKDKFP
YALSQNSANLLH

Enzyme Prediction     

EC	3.2.1.113

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH92	1	227	3.8e-75	0.42769857433808556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3537	COG3537	9.59e-92	1	247	527	762	Putative alpha-1,2-mannosidase [Carbohydrate transport and metabolism].
pfam07971	Glyco_hydro_92	9.27e-87	1	226	249	464	Glycosyl hydrolase family 92. Members of this family are alpha-1,2-mannosidases, enzymes which remove alpha-1,2-linked mannose residues from Man(9)(GlcNAc)(2) by hydrolysis. They are critical for the maturation of N-linked oligosaccharides and ER-associated degradation.
TIGR01180	aman2_put	4.41e-45	1	232	519	749	alpha-1,2-mannosidase, putative. The identification of members of this family as putative alpha-1,2-mannosidases is based on an unpublished characterization of the aman2 gene in Bacillus sp. M-90 by Maruyama,Y., Nakajima,M. and Nakajima,T. (Genbank accession BAA76709, pid g4587313). Most members of this family appear to have signal sequences. Members from the dental pathogen Porphyromonas gingivalis have been described as immunoreactive with periodontitis patient serum. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
NF035929	lectin_1	6.14e-22	20	230	493	685	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSE64256.1	7.44e-134	1	246	472	717
QSE76164.1	4.20e-133	1	245	472	716
AGV73406.1	5.93e-133	1	246	472	717
QRZ11363.1	3.34e-132	1	245	472	716
QEX48787.1	1.19e-129	1	246	472	717

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FE1_A	2.05e-100	1	244	470	710	ChainA, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE1_B Chain B, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE1_C Chain C, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE1_D Chain D, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100]
6DWO_A	2.89e-100	1	244	470	710	Crystalstructure of alpha-1-2-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583],6DWO_B Crystal structure of alpha-1-2-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583],6DWO_C Crystal structure of alpha-1-2-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583],6DWO_D Crystal structure of alpha-1-2-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583]
7FE2_A	5.73e-100	1	244	470	710	ChainA, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE2_B Chain B, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE2_C Chain C, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE2_D Chain D, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100]
2WVY_A	8.68e-61	1	245	492	737	StructureOf The Family Gh92 Inverting Mannosidase Bt2199 From Bacteroides Thetaiotaomicron Vpi-5482 [Bacteroides thetaiotaomicron VPI-5482],2WVY_B Structure Of The Family Gh92 Inverting Mannosidase Bt2199 From Bacteroides Thetaiotaomicron Vpi-5482 [Bacteroides thetaiotaomicron VPI-5482],2WVY_C Structure Of The Family Gh92 Inverting Mannosidase Bt2199 From Bacteroides Thetaiotaomicron Vpi-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW2_A Structure of the Family GH92 Inverting Mannosidase BT2199 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW2_B Structure of the Family GH92 Inverting Mannosidase BT2199 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW2_C Structure of the Family GH92 Inverting Mannosidase BT2199 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
5SWI_A	3.51e-60	1	230	488	716	Crystalstructure of SpGH92 in complex with mannose [Streptococcus pneumoniae],5SWI_B Crystal structure of SpGH92 in complex with mannose [Streptococcus pneumoniae],5SWI_C Crystal structure of SpGH92 in complex with mannose [Streptococcus pneumoniae],5SWI_D Crystal structure of SpGH92 in complex with mannose [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O86365	2.37e-23	20	230	559	754	Uncharacterized glycosidase Rv0584 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0584 PE=3 SV=1
D4ATR3	1.21e-16	25	226	562	741	Uncharacterized secreted glycosidase ARB_07629 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07629 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003404_00438.