CAZyme Information: MGYG000003420_00217

Basic Information

• Species: UBA4372 sp900766785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA4372; UBA4372 sp900766785
• CAZyme ID: MGYG000003420_00217
• CAZy Family: GT14
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301	MGYG000003420_30|CGC1	35559.98	7.9651

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003420	2267758	MAG	Fiji	Oceania

• Gene Location: Start: 4894; End: 5799 Strand: +

Full Sequence      

MNIAYLISAHTDPAQLRRLVLALHPDAEFFIHIDSKSPLEQFTSCLQLPRVHYISERVDV
RWGTMREVQYQMNLIRAAVTFPRQFDRIFFLSGMDYPMWSNARIVNWLEQQGEREILQGY
CMDTVLLDAWQRETYTVARPFCRHVRVGILMRKLLRLTGYRKPLHFSVQGNEWQLYKGSA
WWCISQHLAEYILDQYDHNAELLHYFRNSFCPAETLIQTIAFNHPLWRQRCILTEGKYPG
LELLTPLHFIDYSGFIHVMTEEDHSRLRESGKMFCRKVVTGKSDRIVAMLDKDRAAEAGR
E

Enzyme Prediction     

No EC number prediction in MGYG000003420_00217.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT14	3	233	7.2e-45	0.896

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02485	Branch	1.36e-13	3	232	1	217	Core-2/I-Branching enzyme. This is a family of two different beta-1,6-N-acetylglucosaminyltransferase enzymes, I-branching enzyme and core-2 branching enzyme. I-branching enzyme is responsible for the production of the blood group I-antigen during embryonic development. Core-2 branching enzyme forms crucial side-chain branches in O-glycans. This is a fmmily of glycosyl-transferases that are Type II membrane proteins that are found in the endoplasmic reticulum (ER) and Golgi apparatus.
PLN03183	PLN03183	0.001	173	293	251	363	acetylglucosaminyltransferase family protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIF26868.1	9.32e-137	1	293	1	293
QUB47107.1	3.89e-87	1	294	1	297
AGB28480.1	3.79e-81	1	294	1	297
QUT65527.1	5.48e-59	2	294	3	299
BBK86216.1	1.09e-58	2	294	3	299

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OTK_A	4.67e-07	3	240	86	301	Structureand mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus],3OTK_B Structure and mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus],3OTK_C Structure and mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus],3OTK_D Structure and mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003420_00217.