CAZyme Information: MGYG000003420_01194

Basic Information

• Species: UBA4372 sp900766785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA4372; UBA4372 sp900766785
• CAZyme ID: MGYG000003420_01194
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1295		141189.53	4.6129

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003420	2267758	MAG	Fiji	Oceania

• Gene Location: Start: 22299; End: 26186 Strand: +

Full Sequence      

MPGRILSWVFLSLFVSLGSSSYAFESGQTLCISRGDLSVMPKNSSLSTGALAEMWTDAQT
SSQRWVLQTASSTTFYITNAYTGMILAATSTISAGASVSVLERAAAASRGRWEIVPVEGG
EDEYIIYASTTRRYALSTDAVPADGSTLRLVSVATADSSEFVWKVTECEPQSTSLTQEIR
NDMMEKWKAHYYHKASTGYVIGNGGWWGDAEMFEVVLDALETTGDRQYATMFENLYVNFI
ARKTGNWINGSGYNEYNDDIAWMCIACVRAYLLTGVTKYLTTAKSNFDGMYARAAKYANG
TLVWKQGNGGTTSCINGPAAVCACYLGIALNKEDYFQKAATIYAGERGLLYNINSQGVFN
GQVYDSGDPEKGTVGNTWSSTYNQGTSLGAAVMLYEHFGKEQYRADADAIMNWTAKNLAN
SYGIIKVCQTVNGDLTGFKGILMRYVRRYAASLGHPQWYEWLAKNAFHAWNNRNSAGISM
SAWLTKTPENFYYSDGGDFKNDGVGAFTAVSAAFNAHLGAVDERDAYSVMQAEDFNFLCG
TPIVGSGDDEDGTGYAGNMRKGNYVGYRNVDFGSRYASHIILRASLLRSFSTVNVYLDAP
SETQGTLVCTIQPLSEEERSGWTTIERPLNIPVTGKHDVYFVCAGTAGIDLASINWFQFS
SRNPIFDDVVSPLGVFSTSLDHTPQSLSLLSDANPTTQFCGVAQADGQAWIQYDAPSPVL
LQGYSLFSGYNSTADPSGWELMGSEDGQSWTSLHEVSEATFVARGQSLKFDLNIDQPYQH
FRLLLHGQANQTSFYLSEWQLMGRSVSSVDITADGGSISEAESLIDHQGLTSAVVPQAGV
VYRAAGNYALTHYSLTTSATHAPVSWVLEGSTNGTVWKVVDERQDVTFPYPVTTSVFEVQ
DAQVYIWYRLRMTAEGEAHLNQWQMFGRLDMGTVYPDVTTLMQVTGPDGSAQSMLVDDRI
ETFSSVTGDSLYWLLESPLPVRPLAYSVIASADMDQTPTSVSVRGLSDDGAASVLSTRSI
ALNARGSRYTSTMATSKNFSRFQLLVNSTRTEEGKAASLTGFELYGTVVADAEAEALNVP
ASVESTSEGASTTEVIDKLTDQNRLTAYRADIQDSVLITFSYATPVSVDCYAITAGKDKA
ECDPSDWEFQGSADGVEWVTLDSRSGELFSHRYATQFYRLSQSVSYPYYRLLVHSVNGGL
QLQMTELQLFHLGMGTSLLPVPGGLLSADIQVRSGRVQVDVPQSAVLCVYDTEGRLLDAH
RLEAGSSTLPVPAAQGILLFVLRTPGGSLVRKVRL

Enzyme Prediction     

No EC number prediction in MGYG000003420_01194.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	176	484	1.2e-50	0.8603351955307262
CBM6	531	660	3.1e-17	0.8623188405797102

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	5.27e-35	190	471	15	315	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
cd04084	CBM6_xylanase-like	3.52e-17	528	659	1	123	Carbohydrate Binding Module 6 (CBM6); many are appended to glycoside hydrolase (GH) family 11 and GH43 xylanase domains. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family domains, including GH3, GH11, and GH43 domains. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB6s belonging to this family are Microbispora bispora GghA, a 1,4-beta-D-glucan glucohydrolase (GH3); Clostridium thermocellum xylanase U (GH11), and Penicillium purpurogenum ABF3, a bifunctional alpha-L-arabinofuranosidase/xylobiohydrolase (GH43). GH3 comprises enzymes with activities including beta-glucosidase (hydrolyzes beta-galactosidase) and beta-xylosidase (hydrolyzes 1,4-beta-D-xylosidase). GH11 family comprises enzymes with xylanase (endo-1,4-beta-xylanase) activity which catalyze the hydrolysis of beta-1,4 bonds of xylan, the major component of hemicelluloses, to generate xylooligosaccharides and xylose. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold.
pfam03422	CBM_6	3.26e-13	531	661	1	125	Carbohydrate binding module (family 6).
COG4833	COG4833	2.62e-12	206	473	46	310	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
smart00606	CBD_IV	1.69e-09	524	659	2	129	Cellulose Binding Domain Type IV.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT74831.1	9.64e-230	26	1281	24	1295
QIA07414.1	3.03e-88	124	699	164	708
QOV19890.1	6.43e-73	177	663	29	496
QEC70572.1	1.20e-63	4	515	2	494
AYD48939.1	4.17e-59	42	516	48	495

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M77_A	6.15e-48	207	673	73	536	ChainA, Alpha-1,6-mannanase [Niallia circulans],5M77_B Chain B, Alpha-1,6-mannanase [Niallia circulans]
4BOK_A	1.32e-36	207	494	39	328	ChainA, Alpha-1,6-mannanase [Niallia circulans]
4BOJ_A	1.42e-36	207	494	42	331	ChainA, Alpha-1,6-mannanase [Niallia circulans],4BOJ_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4BOJ_C Chain C, Alpha-1,6-mannanase [Niallia circulans]
4D4A_A	7.11e-36	207	494	60	349	ChainA, Alpha-1,6-mannanase [Niallia circulans],4D4A_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4B_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4B_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4C_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4C_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4D_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4D_B Chain B, Alpha-1,6-mannanase [Niallia circulans],5N0F_A Chain A, Alpha-1,6-mannanase [Niallia circulans],5N0F_B Chain B, Alpha-1,6-mannanase [Niallia circulans],6ZBX_A Chain A, Alpha-1,6-mannanase [Niallia circulans],6ZBX_B Chain B, Alpha-1,6-mannanase [Niallia circulans],7NL5_A Chain A, Alpha-1,6-mannanase [Niallia circulans]
5AGD_A	3.23e-35	207	494	60	349	ChainA, Alpha-1,6-mannanase [Niallia circulans],5AGD_B Chain B, Alpha-1,6-mannanase [Niallia circulans],6ZBM_A Chain A, Alpha-1,6-mannanase [Niallia circulans],6ZBW_A Chain A, Alpha-1,6-mannanase [Niallia circulans],6ZBW_B Chain B, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000232	0.999134	0.000155	0.000163	0.000147	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003420_01194.