CAZyme Information: MGYG000003420_01708

Basic Information

• Species: UBA4372 sp900766785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA4372; UBA4372 sp900766785
• CAZyme ID: MGYG000003420_01708
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
599		67344.9	6.3039

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003420	2267758	MAG	Fiji	Oceania

• Gene Location: Start: 2154; End: 3953 Strand: -

Full Sequence      

MKHLLLPLAMLLSANTLLAQENLPPVLKADSANFRKDILTRTYMTPKRILWSSSPTSVQN
PELLLKPNTGQADIFGEGMCRLVNNGEDRASIILDFGHEIHGGLKLVISSCAPLVTPQVR
LRFGESVSETCSELNSSKSVAETGSKSEVDLKSNTATNDHAIRDMVLTVPFYGQMEVGNT
GYRFVRIDLLTPGQTINLKEATAILRYRDIPYLGTFRCSDQRLNDIWMTGAYTVHLNMQE
YIWDGIKRDRLVWLGDMHPETSTIGNVFGDEESFYASMDLACQQYPLPAWINGMSAYSLW
YLIIQYDWYMRFGHKEYLEKHRDYILGLVDLIDKCIDAQGNDAMGAHFLDWPSSTNPEGV
DAGYHALLVWAMQDAQRMSILLGDEARAQKCREVEDRLRRKVVNPNGLKQAASLMAIAGL
MDPAKACRDYVSVGGPKGFSTFYGYYMLEALAMDGRYEEAMDIISQYWGGMLDMGATTFW
EDFDLEWTRNAGRIDDFVPEGKKDIHGDFGAYCYPGFRHSFCHGWASGPTAWMSTHVLGV
EILEAGCKRVRITPHLGRLQWAEGTFPTPYGQISIRHERRVDGSVKSSIKAPKGVKVVK

Enzyme Prediction     

No EC number prediction in MGYG000003420_01708.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	90	597	2.7e-96	0.9781746031746031

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.17e-21	214	537	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.10e-06	539	596	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT69834.1	7.69e-274	18	599	20	590
QUT42018.1	3.12e-273	18	599	20	590
QDO68956.1	5.63e-273	19	598	19	587
QUT59644.1	5.12e-272	14	598	15	588
BCA48698.1	2.07e-271	18	599	20	590

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	9.11e-40	87	580	189	679	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	3.13e-11	91	532	94	536	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000272	0.999079	0.000178	0.000166	0.000144	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003420_01708.