CAZyme Information: MGYG000003470_00287

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA4372
• CAZyme ID: MGYG000003470_00287
• CAZy Family: GH2
• CAZyme Description: Evolved beta-galactosidase subunit alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1210		136423.88	7.0881

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003470	2121809	MAG	Fiji	Oceania

• Gene Location: Start: 132; End: 3764 Strand: +

Full Sequence      

MNQPVIFQHRVAVGDWKGGVMRTPPTHWTTYKHRNEVGSYLRTFTIPADWKGREVFISFD
GVDSFFYLWINGKYVGFSKNSRNAAEFNITPYLNEEGENTVAVEVYRSSDGSFLEAQDMF
RLPGIFRTVAIQSRPAVRVRDLVVKPDLDENYQNGVLNISADLLNTSKKNVKNLKMRYTL
YQHELYDDNNKPTDVIAYSAPFTLNKLTGKATVKAELKMIEPRKWTAEAPYRYTLVGELL
DKKGRVLETVSTIVGFREVEIKDTKAEDDEFGLAGRYYYINGKTVKLKGVNRHESHPAVG
HAITREMQKEEVMLMKRANINHVRNSHYPCDPYWYFLCDKYGIYLEDEANIESHEYYYGE
ASISHPEEWKKAHVARVMEMAHANVNNACIVIWSLGNEAGPGKNFVAAYDALKAFDSTRP
VQYERNNDIVDMGSNQYPSIGWTRGAVTGKYNIKYPFHISEYAHSMGNAVGNLIDYWDAM
ESTNFFCGGAIWDWVDQSMYNYEKDGTRYLAYGGNFGDTPNDGQFVMNGIIFGDREPKPQ
YYEVKKVYQYVGVKMLDAKQGKVEIFNKNYYTPLNDYEIVWSLWVNGKCVQQNQPVQGPR
MALQPRQKAVYTLPYNFASLNPKDEVFVKVQFLLGHDMPWAKQGYPQFEEQLLVASPSVA
APAISQVAENAGKLEVSADADKAFQTIKGEGFEVQFDMKQGTINKLVYGGESVIVPGYGP
RLNAFRAFVSNDNWCYQPWFANGLHNLKHRAENAQVIKEKNGNVKITCTVVSQAPNAARL
QSKNGRYDSGIHTLEENTDRPFGADDFKFTTNQIWTIYPDGSIELQAAITSNNPGIVLAR
LGYEMGVPAQYDRFAYYGRGPVDNYNDRKTGQFIEQFSSTVAEQFTNWPKPQQMGNHEET
RWTTLSNAKGKGILVVNEKPYAVSALNHSAMDMTMATHPHKLPKSDINYLTIDAMVTGLG
GNSCGQGGPLPHDRAFGAPTRMGFIIRPVGAKGGVDVSTASQKPLLMMQQKNGDVTIESG
IEGATIMYKIGKAKKAKEYTGPISFRDGGTITAFYKENPELQVTMTYAKIEKINTEVVFT
SSEEAGEGNASHLTDGDINTIWHTMYSVTVAKYPHWVDFDAGDVKNIKGFIYLPRQDGPN
GNIKDYEILVSQDGKNWGEPIMKGTFENNQKEKKVMLKAPVKARYFRFRALSSQNGQDFA
SGSEFSIIAE

Enzyme Prediction     

No EC number prediction in MGYG000003470_00287.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	25	874	4.6e-194	0.9215425531914894
CBM32	1080	1206	1.1e-25	0.9193548387096774

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10340	ebgA	0.0	35	966	108	978	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	1.86e-178	35	961	119	999	beta-galactosidase.
COG3250	LacZ	8.09e-114	34	593	79	607	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	6.01e-77	278	551	8	300	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
smart01038	Bgal_small_N	6.10e-73	688	986	1	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT51391.1	0.0	1	1210	140	1343
QCQ49582.1	0.0	1	1210	137	1341
QCQ33874.1	0.0	1	1210	137	1341
QRM72246.1	0.0	1	1210	137	1341
AUI47491.1	0.0	1	1210	137	1341

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	1.59e-154	32	987	105	980	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	1.63e-154	32	987	106	981	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3DEC_A	1.04e-145	22	989	111	997	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
3BGA_A	1.50e-140	35	967	125	980	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
3MUY_1	1.41e-110	35	962	118	996	Chain1, Beta-D-galactosidase [Escherichia coli K-12],3MUY_2 Chain 2, Beta-D-galactosidase [Escherichia coli K-12],3MUY_3 Chain 3, Beta-D-galactosidase [Escherichia coli K-12],3MUY_4 Chain 4, Beta-D-galactosidase [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O52847	5.48e-173	8	972	108	1016	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
Q56307	8.93e-154	32	987	106	981	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
P06864	1.74e-142	35	1001	108	1012	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
A1SWB8	5.81e-136	35	973	117	1017	Beta-galactosidase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=lacZ PE=3 SV=1
Q9K9C6	7.10e-133	35	987	119	1000	Beta-galactosidase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999992	0.000041	0.000006	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003470_00287.