CAZyme Information: MGYG000003494_00761

Basic Information

• Species: Ruminiclostridium_E sp900768735
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminiclostridium_E; Ruminiclostridium_E sp900768735
• CAZyme ID: MGYG000003494_00761
• CAZy Family: CE4
• CAZyme Description: Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
289		31767.74	4.6077

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003494	2318157	MAG	Fiji	Oceania

• Gene Location: Start: 19043; End: 19912 Strand: -

Full Sequence      

MKNEKNTAIAAIIVGIVSIALMIGILFAATSAAAAENKGQVFGLMYHQVLKDESRHGRYV
VSPYELEADLKYLSENGFTSLFASEVAQIIDSGGKIPDKAVVITLDDGYETGLDYVVPLL
KKYNMKAVINIVGEYTDEYSALSENEKSLSYAYLTWDEIKELSDSGVVEIGNHTYYMHGN
DYTRHGCSINYGEDSASYHDALVKDIGTLQDKIEQVTGTRPVTFAYPYGIISEGSMSAIG
ETGIKVFLTCNEKPSDISGAPVVINRYNREHGRSAQELYALYQSACDRL

Enzyme Prediction     

No EC number prediction in MGYG000003494_00761.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	95	247	3e-28	0.9230769230769231

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10918	CE4_NodB_like_5s_6s	2.89e-40	100	272	1	157	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10969	CE4_Ecf1_like_5s	1.53e-38	63	268	1	201	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
PRK14582	pgaB	1.80e-28	38	258	46	282	poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB.
PRK14581	hmsF	1.66e-27	44	258	52	282	outer membrane N-deacetylase; Provisional
cd10966	CE4_yadE_5s	5.45e-27	97	268	1	154	Putative catalytic polysaccharide deacetylase domain of uncharacterized protein yadE and similar proteins. This family contains an uncharacterized protein yadE from Escherichia coli and its bacterial homologs. Although its molecular function remains unknown, yadE shows high sequence similarity with the catalytic NodB homology domain of outer membrane lipoprotein PgaB and the surface-attached protein intercellular adhesion protein IcaB. Both PgaB and IcaB are essential in bacterial biofilm formation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFS79569.1	5.01e-37	44	278	34	267
AAM25723.1	1.07e-28	16	229	15	239
AEE91926.1	7.29e-27	27	266	29	261
CCP26752.1	7.29e-27	27	266	29	261
ARI76505.1	2.09e-26	40	278	226	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4U10_A	7.48e-21	44	253	7	235	Probingthe structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans],4U10_B Probing the structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans]
4F9D_A	3.76e-15	44	289	15	279	Structureof Escherichia coli PgaB 42-655 in complex with nickel [Escherichia coli K-12],4F9D_B Structure of Escherichia coli PgaB 42-655 in complex with nickel [Escherichia coli K-12]
3VUS_A	5.83e-15	44	278	11	264	Escherichiacoli PgaB N-terminal domain [Escherichia coli K-12],3VUS_B Escherichia coli PgaB N-terminal domain [Escherichia coli K-12]
4F9J_A	1.24e-14	44	289	15	279	Structureof Escherichia coli PgaB 42-655 in complex with iron [Escherichia coli K-12],4F9J_B Structure of Escherichia coli PgaB 42-655 in complex with iron [Escherichia coli K-12]
5BU6_A	1.66e-14	71	266	48	260	Structureof BpsB deaceylase domain from Bordetella bronchiseptica [Bordetella bronchiseptica RB50],5BU6_B Structure of BpsB deaceylase domain from Bordetella bronchiseptica [Bordetella bronchiseptica RB50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P75906	2.14e-14	44	289	52	316	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Escherichia coli (strain K12) OX=83333 GN=pgaB PE=1 SV=1
Q8XAR3	2.88e-14	44	289	52	316	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Escherichia coli O157:H7 OX=83334 GN=pgaB PE=3 SV=1
P94361	4.41e-13	44	284	68	277	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
P31666	1.32e-12	21	256	150	380	Uncharacterized protein YadE OS=Escherichia coli (strain K12) OX=83333 GN=yadE PE=3 SV=2
Q5HKP8	6.11e-09	38	253	41	254	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.042814	0.954841	0.000961	0.000558	0.000409	0.000375

TMHMM  Annotations     

start	end
13	35