CAZyme Information: MGYG000003494_01937

Basic Information

• Species: Ruminiclostridium_E sp900768735
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminiclostridium_E; Ruminiclostridium_E sp900768735
• CAZyme ID: MGYG000003494_01937
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
626	MGYG000003494_460|CGC1	68374.79	9.2068

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003494	2318157	MAG	Fiji	Oceania

• Gene Location: Start: 4940; End: 6820 Strand: -

Full Sequence      

MEKSKASFSYFIKRMSVILTALFAIVLCICALTAPSSAANEGFYVSGTDICDANGNSFEM
RGVNIAHAWYKSYTETSIKAAANLGANTVRIVLSDGVQWTKTTYSEVENIISLCKQNKVV
CVLEVHDATGSNSTADLDSAVSYWIEMKELLNSNTEYVILNIANEWCGSWDSSTWAEGYK
SAIKSLRTAGINNMIMVDCAGWGQYPDSIKYYGKEVFDADSQKNTVFSIHMYEYSGGNST
TVKTNIDNALSIGVPVVIGEFGNRHTNGDVDEQTILSYCEQKNVGYLGWSWKGNSGGVEY
LDLSDTWDGSSLTEWGNTLFYDTNGIKNTSTICSVYTGGQSGNEDFSNEKITGFTLGGRA
ADALRLNWNKNTSADGYIIEKYDGSKWVRIAKLTNNVTTTYRVTGLAAGKAYKFRMRAYK
MDGTTALYSGYTSTLAARTNPSNVTGLTLGGRAADALRLNWNKNTSADGYIIEKYNGTAW
VRIAKITNNTTATYRAEGLSAGTAYKFRMRAYKMSGSTPLYSGYTATLAARTNPSKVTGV
KIGGTASTALRMNWTKNTSADGYIIEIYKDGKWVRAAKITNNATTTYRISGLAKNTTYQL
RIKAYKMSGKTALYSGYTAVSGKTAK

Enzyme Prediction     

No EC number prediction in MGYG000003494_01937.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	52	298	1.3e-94	0.9881422924901185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	3.42e-39	51	295	1	272	Cellulase (glycosyl hydrolase family 5).
cd00063	FN3	2.13e-07	534	610	1	82	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
cd00063	FN3	2.72e-07	441	527	1	93	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
smart00060	FN3	1.36e-06	534	609	1	81	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.
cd00063	FN3	7.50e-06	352	424	5	82	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU21877.1	1.18e-161	20	338	17	335
CCO04360.1	3.81e-158	9	341	6	338
ADU23074.1	2.30e-151	36	400	29	391
QKS47268.1	1.71e-137	33	543	403	905
CDM68969.1	2.39e-131	31	351	28	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1WKY_A	8.16e-132	39	341	6	308	Crystalstructure of alkaline mannanase from Bacillus sp. strain JAMB-602: catalytic domain and its Carbohydrate Binding Module [Bacillus sp. JAMB-602]
3JUG_A	8.99e-124	36	340	18	322	Crystalstructure of endo-beta-1,4-mannanase from the alkaliphilic Bacillus sp. N16-5 [Bacillus sp. N16-5]
2WHJ_A	5.12e-121	42	345	2	305	Understandinghow diverse mannanases recognise heterogeneous substrates [Salipaludibacillus agaradhaerens]
2WHL_A	4.03e-116	42	336	1	293	Understandinghow diverse mannanases recognise heterogeneous substrates [Salipaludibacillus agaradhaerens]
1BQC_A	3.54e-83	42	336	3	301	Beta-MannanaseFrom Thermomonospora Fusca [Thermobifida fusca],2MAN_A Mannotriose Complex Of Thermomonospora Fusca Beta-Mannanase [Thermobifida fusca],3MAN_A Mannohexaose Complex Of Thermomonospora Fusca Beta-mannanase [Thermobifida fusca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G1K3N4	2.80e-120	42	345	2	305	Mannan endo-1,4-beta-mannosidase OS=Salipaludibacillus agaradhaerens OX=76935 PE=1 SV=1
P51529	3.72e-84	23	339	16	338	Mannan endo-1,4-beta-mannosidase OS=Streptomyces lividans OX=1916 GN=manA PE=1 SV=2
B3PF24	2.38e-76	9	341	20	350	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=man5A PE=1 SV=1
P22533	1.08e-60	62	331	55	326	Beta-mannanase/endoglucanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=manA PE=1 SV=2
P50899	1.48e-12	352	624	708	983	Exoglucanase B OS=Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / NBRC 15513 / NCIMB 8980 / NCTC 7547) OX=590998 GN=cbhB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.029492	0.947346	0.021928	0.000582	0.000308	0.000313

TMHMM  Annotations     

start	end
17	39