CAZyme Information: MGYG000003508_00875

Basic Information

• Species: UBA7597 sp003448195
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA7597; UBA7597 sp003448195
• CAZyme ID: MGYG000003508_00875
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
715		80947.43	4.8496

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003508	1808290	MAG	Fiji	Oceania

• Gene Location: Start: 20851; End: 22998 Strand: -

Full Sequence      

MWIKCKDESKNEGLPVFVKTFTVKKRFTRCELKITATGIFCVKINGTALSDRFMPGWSNY
RKHIDVCSYDVTEYVTEGRENEIAVTVANGWYSGKLGYGNKTNVFGSEKRLLASISFAYG
NGDTEIIESDESWQTVVSDVVFADFFDGEIIDASRRKIEKKAENAVNADFAVPLQDYARE
PVRVAERIKPQVIYSDETTLRYDFGYNFAGCVKVIAKGGKGSGIVAIYGETLDENGNVYT
ANLRRAKCTDEFILSGEEDVFEPEFTYHGFRYAELRKTRETEILFIEGVALSQDIKYYGN
FECSDEVTNGVWLMALRGQKSNFISIPTDCPQRDERLGWTGDAEVFCNSAMFNADCNLFF
KNYLKLVREDALPDGKIPSIVPFYMPLSDNTAGVPGWGDCITVMPYFHYLHYRDKSVIAE
NLPVAEKWIAYYVAKSENYLTKITNNFGDWLSVNGDSDPDVINQCFFGYSASLTAKMCDI
LGLHDKSAAYLDLFGKCKKAFRENYYHDGKIKSDTQTTYAFAYIAGYLSKEETAARLPEK
IRENGGGLTTGFIGSRFILPALCDIGETKLAYSLMMRTEYPSWGYMLKNGATTVWERWNG
YTRENGFEDPEMNSFNHYSLGSCVEWLYSYVLGIKLSPETEKATIDPSFCDLLSFAKGET
QLKNGRISVSWKYENASVYLEVKADEDIEYEIDCKDKKIISMIRTGNDTIAVFRA

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	196	691	1.1e-147	0.9841269841269841
CBM67	2	156	5.8e-19	0.8238636363636364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	8.41e-114	299	631	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.46e-32	25	201	1	169	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.23e-23	195	275	4	84	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	0.009	642	683	11	52	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNF26773.1	2.69e-150	19	689	149	860
ASV74703.1	5.46e-148	13	677	335	1012
AXY78413.1	4.31e-147	7	683	145	846
ASU32381.1	3.09e-146	6	683	144	850
QHS58542.1	1.25e-143	15	682	156	850

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	3.41e-120	25	692	314	992	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	3.15e-96	17	635	134	779	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	4.47e-90	15	692	177	898	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	2.93e-121	19	693	179	877	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	1.44e-119	25	692	314	992	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	3.65e-114	2	671	150	855	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	4.13e-53	17	706	187	918	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003508_00875.