CAZyme Information: MGYG000003533_01838

Basic Information

• Species: SFTJ01 sp900769345
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; SFTJ01; SFTJ01 sp900769345
• CAZyme ID: MGYG000003533_01838
• CAZy Family: GH16
• CAZyme Description: Arylsulfatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505	MGYG000003533_144|CGC1	55987.79	6.2296

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003533	2902010	MAG	Fiji	Oceania

• Gene Location: Start: 117; End: 1634 Strand: -

Full Sequence      

MKTLAAAMACTALTANAAGDNRPNILVFLVDDMGWQDTSVPFWTETTPLNKRYHTPNMER
LASQGMKFTQAYASAISSPSRCSLLTGANAARHRVTNWTLQRDRKVDAPNDVIDVPEWNY
NGISQTPGTPHTYVATSVVQLLHNAGYHTIHCGKAHWGAIDTPGENPHHFGFDVNIAGHA
AGGLATYYSELNYGHDANGKPTSLMSIPGLEKYWQTGTFVTEALTREAIAALDKAKRYNQ
PFFLYMSHYAIHVPIDRDPRYFDRYKREGLSDKEAAYASLVEGMDKSLGDLMDWLEANDE
AENTVVIFMSDNGGYATGTHWRDEPLYTQNAPLRCGKGSAYEGGVREPMIVSWQGVTAPG
SVQDAQVIIEDFFPTLLEMAGVNDWQVPQAVDGRSFVPLLRGESAKSRSLIWNCPNIWDN
SGPGIGATCTIRQGDWKLIYYYENGKKELYDVAHDIGETCDLSSERPYVTKRLSAALGKR
LRAMNAQRPSFKATGNPCPWPDEVK

Enzyme Prediction     

No EC number prediction in MGYG000003533_01838.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16144	ARS_like	1.74e-175	23	477	1	418	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16146	ARS_like	7.85e-95	23	477	1	401	uncharacterized arylsulfatase. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16145	ARS_like	4.32e-92	23	467	1	415	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16026	GALNS_like	1.41e-84	22	463	1	399	galactosamine-6-sulfatase; also known as N-acetylgalactosamine-6-sulfatase (GALNS). Lysosomal galactosamine-6-sulfatase removes sulfate groups from a terminal N-acetylgalactosamine-6-sulfate (or galactose-6-sulfate) in mucopolysaccharides such as keratan sulfate and chondroitin-6-sulfate. Defects in GALNS lead to accumulation of substrates, resulting in the development of the lysosomal storage disease mucopolysaccharidosis IV A.
cd16025	PAS_like	1.32e-80	21	462	1	402	Bacterial Arylsulfatase of Pseudomonas aeruginosa and related proteins. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89376.1	2.96e-176	13	502	14	498
ALJ59588.1	1.18e-175	13	502	14	498
EAR02039.1	1.87e-175	22	504	28	511
AKJ65363.1	1.16e-70	22	490	26	453
QNM84315.1	1.69e-45	21	474	36	443

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6USS_A	1.84e-245	20	504	31	517	ChainA, Sulfatase [Bacteroides fragilis CAG:558],6USS_B Chain B, Sulfatase [Bacteroides fragilis CAG:558]
6UST_A	2.54e-76	22	489	4	461	ChainA, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi],6UST_B Chain B, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi],6UST_C Chain C, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi],6UST_D Chain D, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi]
7STT_A	3.56e-60	19	489	3	441	ChainA, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis],7STU_A Chain A, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis],7STV_A Chain A, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis]
6PSM_A	1.80e-43	21	477	23	433	Crystalstructure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_B Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_C Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_D Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_E Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_F Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSO_A Crystal structure of PsS1_19B C77S in complex with iota-neocarratetraose [Pseudoalteromonas fuliginea],6PSO_B Crystal structure of PsS1_19B C77S in complex with iota-neocarratetraose [Pseudoalteromonas fuliginea]
6PRM_A	9.05e-43	21	477	23	433	Crystalstructure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_B Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_C Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_D Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ9	7.78e-53	20	483	32	521	Sulfatase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22020 PE=3 SV=1
P77318	1.12e-33	22	477	57	530	Uncharacterized sulfatase YdeN OS=Escherichia coli (strain K12) OX=83333 GN=ydeN PE=3 SV=2
P51691	7.65e-33	22	467	4	507	Arylsulfatase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=atsA PE=1 SV=3
P34059	6.70e-31	23	500	31	491	N-acetylgalactosamine-6-sulfatase OS=Homo sapiens OX=9606 GN=GALNS PE=1 SV=1
Q9C0V7	1.20e-30	18	473	7	519	Uncharacterized sulfatase PB10D8.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBPB10D8.02c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000479	0.998631	0.000267	0.000222	0.000192	0.000174

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003533_01838.