CAZyme Information: MGYG000003556_00565

Basic Information

• Species: Alistipes sp900769745
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900769745
• CAZyme ID: MGYG000003556_00565
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
466		52177.64	6.0283

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003556	2131277	MAG	Fiji	Oceania

• Gene Location: Start: 578; End: 1978 Strand: -

Full Sequence      

MKRLLLIVALIACGFIQSCCNQCGGENYTIKDGIIHFAEPERAPGQQTMLAFAAEPIPTV
RVGFVGIGMRGSAAVERFTHLEGIEVKGLCDLVQANIDKCQKMLTDAQMPKADEYLGEEE
YKKLCEREDVDLIYISTPCTKHVDVALYAMEQGKHVAVEVPAAITLEECWKLVDTSERTR
RHCMMLENCIYDFFELTAMNMAHQGVFGEIVHAEGAYIHNLGPYWEGSYQNWRVKFNMSN
RGDLYPTHGFGPICMALNIHRGNKLNYLVSMDTKPANSAEVGKKYGGFEECKSGDHTVTL
IKTEKEQTIEVHYNVYSPRPYSRMYQLTGTKGFANKYPVSGFTFTEGSLKEGVLPEGTKL
DEHGFASQEVMAAAMEAYKHPIHREIEEMAKKVGGHGGMDFVMDYRLIYCLRNGLPLDQD
VYDAAEWSSIISLSAASLEHGSKPVAIPDFTRGDWNKLQGVTFHTK

Enzyme Prediction     

No EC number prediction in MGYG000003556_00565.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	57	457	1.8e-157	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	2.91e-22	58	379	2	306	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.20e-11	60	185	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	1.10e-06	129	214	64	149	putative oxidoreductase; Provisional
COG4091	COG4091	0.003	49	166	8	140	Predicted homoserine dehydrogenase, contains C-terminal SAF domain [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL06379.1	3.60e-207	9	460	5	458
BBL11909.1	2.40e-205	20	460	19	459
BBL01207.1	2.40e-205	20	460	19	459
BBL09117.1	2.40e-205	20	460	19	459
AFL77663.1	5.87e-201	1	460	1	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	9.65e-90	42	455	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	1.35e-60	60	461	21	437	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E18_A	1.07e-12	65	332	11	246	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]
3EC7_A	4.55e-10	59	215	23	174	CrystalStructure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_B Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_C Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_D Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_E Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_F Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_G Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_H Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
1OFG_A	1.59e-09	50	251	19	218	ChainA, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_B Chain B, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_C Chain C, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_D Chain D, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_E Chain E, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_F Chain F, Glucose-fructose Oxidoreductase [Zymomonas mobilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C863	2.01e-180	24	460	20	457	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1
Q5LGZ0	2.01e-180	24	460	20	457	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1
Q89ZX8	1.82e-179	1	460	1	460	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
Q7MWF4	7.61e-179	35	460	33	461	Glycosyl hydrolase family 109 protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=PG_0664 PE=3 SV=2
A6KX96	3.41e-178	40	460	41	464	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000004	0.001974	0.998050	0.000001	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003556_00565.