CAZyme Information: MGYG000003575_00957

Basic Information

• Species: Treponema_D sp900770075
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp900770075
• CAZyme ID: MGYG000003575_00957
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375		41263.9	9.3385

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003575	2346376	MAG	Fiji	Oceania

• Gene Location: Start: 16230; End: 17357 Strand: -

Full Sequence      

MTEKIVFAGGGTGGHIYPGLAVADELKKIAEKNNRKIKIYWFGNSGGMDRKLVEKSGIAD
VFCGIPSGKLRRYFSIKNFFDFFKILAGIFVSFFRLLFIRPSLVFSKGGFVSVPPCFAAW
ILRIPVFTHECDFTPGLATKINSRFAAKILVSYPETVKFLPKNRQARAVVSGNPVRPAFY
EADAGRGREFLSGNKEWVPSKPVLLVLGGSLGARQLNELVVQNLSWLTERFIVVHQCGAK
DASFVPERSDCYFPYPFIYEQMPDVIACADVVLSRAGASTVWESAVEGKPSVLVPLCGSG
TRGDQVDNAGFFASRGAAFVLNGEEAVFEKLRDCLERLLDEKTRLEMGQKMAELAAGKRS
SLKIAEIIGDVINAF

Enzyme Prediction     

No EC number prediction in MGYG000003575_00957.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	204	355	2.6e-38	0.9617834394904459

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	9.70e-126	4	372	3	355	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	1.15e-112	4	371	1	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	2.03e-103	4	368	2	351	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	5.87e-101	4	368	2	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK12446	PRK12446	3.77e-80	3	344	2	328	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSI01832.1	7.40e-165	3	368	6	372
QQA00106.1	2.02e-143	4	368	9	379
AEE16579.1	1.65e-138	5	368	12	380
QOS40075.1	1.66e-135	4	368	9	379
QTQ13889.1	6.29e-131	4	368	3	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	2.93e-29	3	355	10	350	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	3.85e-28	1	321	1	304	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	9.92e-28	3	296	7	282	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q73L91	2.55e-114	5	368	4	380	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104) OX=243275 GN=murG PE=3 SV=1
O83535	2.44e-102	5	338	15	345	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Treponema pallidum (strain Nichols) OX=243276 GN=murG PE=3 SV=1
B2S3B6	2.44e-102	5	338	15	345	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Treponema pallidum subsp. pallidum (strain SS14) OX=455434 GN=murG PE=3 SV=1
C1FUF9	1.43e-76	3	340	2	324	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium botulinum (strain Kyoto / Type A2) OX=536232 GN=murG PE=3 SV=1
A7FX11	2.02e-76	3	325	2	309	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
79	98