CAZyme Information: MGYG000003575_01355

Basic Information

• Species: Treponema_D sp900770075
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp900770075
• CAZyme ID: MGYG000003575_01355
• CAZy Family: GT26
• CAZyme Description: UDP-N-acetyl-D-mannosaminuronic acid transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
257	MGYG000003575_180|CGC1	29997.57	10.2813

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003575	2346376	MAG	Fiji	Oceania

• Gene Location: Start: 10110; End: 10883 Strand: -

Full Sequence      

MAEEMREENSKLNRISLLGVPMDVCRPEDMDEVILEILAKPGIKQIVFLSVWDLLKGRNK
KKNFSKYLHSADLILPVSKSLLWGAKFLKKPVPVRYNPFSAVISILSVMENHYKSLFLLG
GRKKALQKAECNVRSTLPNLQIVGRYVGYYPKEVEKDVVQAIYKASPSLVIVGDGIKEKK
LWAYNRRNNFASSIFLYYKDCIGIFSERVKRINEKTFDRGLEIWSEIFKNPFKLFLIFPF
LRYIILVIWYRLFKKNC

Enzyme Prediction     

No EC number prediction in MGYG000003575_01355.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT26	68	233	2.7e-27	0.9649122807017544

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1922	WecG	1.23e-38	9	256	4	253	UDP-N-acetyl-D-mannosaminuronic acid transferase, WecB/TagA/CpsF family [Cell wall/membrane/envelope biogenesis].
pfam03808	Glyco_tran_WecB	6.70e-38	71	235	1	166	Glycosyl transferase WecB/TagA/CpsF family.
cd06533	Glyco_transf_WecG_TagA	7.76e-20	70	211	3	144	The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins. E. coli WecG is believed to be a UDP-N-acetyl-D-mannosaminuronic acid transferase, and is involved in enterobacterial common antigen (eca) synthesis. B. subtilis TagA plays a key role in the Wall Teichoic Acid (WTA) biosynthetic pathway, catalyzing the transfer of N-acetylmannosamine to the C4 hydroxyl of a membrane-anchored N-acetylglucosaminyl diphospholipid to make ManNAc-beta-(1,4)-GlcNAc-pp-undecaprenyl. This is the first committed step in this pathway. Also included in this group is Xanthomonas campestris pv. campestris GumM, a glycosyltransferase participating in the biosynthesis of the exopolysaccharide xanthan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSI01406.1	4.05e-122	11	256	2	247
QNL96733.1	2.68e-114	12	256	3	246
QQA00783.1	5.59e-114	12	255	3	245
QTQ13284.1	1.97e-109	12	256	3	246
QTQ15518.1	1.97e-109	12	256	3	246

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000079	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
234	253