CAZyme Information: MGYG000003584_00190

Basic Information

• Species: HGM11412 sp900770185
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; HGM11412; HGM11412 sp900770185
• CAZyme ID: MGYG000003584_00190
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
712	MGYG000003584_6|CGC1	80130.66	4.9968

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003584	1810421	MAG	Fiji	Oceania

• Gene Location: Start: 185; End: 2323 Strand: -

Full Sequence      

MWIKRRDNNVKSGLPIFRKKFTASGSLTRCELKITATGIFNVQINGHEIPDLFMPGWTNY
LKRIDLCRYDVTEFIKSENEISVTVANGWYSGKLGYGNKTNVFGDEKRLYAEITLYYSDG
ETETVTTDESWETLDSDVLFADFFDGEVSDARRRGKVINEAPAEIAEFSVPFTDYAREPV
RITESLSAKIIYEDDTTVRYDFGRNFVGVLKITAKGNAGDKIVVKYGEMLDGGEVYVANL
RRAKCTDEFILSGGLDVFEPKFTYHGFRYAEIKKDSGVRILETLGKVISQNVEYYGGFEC
SDGTINGIYEMALNGQKSNFIAIPTDCPQRDERLGWTGDAEVFCNSAMFNANCDLFFKNY
LGLVRDDMLKDGRVPSIVPLYMPVADNTAGVPGWGDVICVMPYFHYLHYRDASVIKDNLS
AAEAWVGYYIKKSKNYLTKITNNFGDWLSIDGETDADVINQCFFGYSTLLTAKMCEILGD
IDKKARYTGVYENCKQAFRDNYLTFGRIKSDTQTAYAFAYAAGFITREETAARLPAAVHK
KGDSLTTGFIGSRFILPVLCDIGEAELAYKLIRRTEYPSLGYMLKEGATTVWERWNGYTE
KDGFEDPEMNSFNHYSLGSCTEWLYSYVLGIKLSPYTETVVISPSFSRDLSYARGETKLK
GGKISVFWQYENAAVKLIVKAADGVHYEIDKSCGELISLTKTGNETVAVFKA

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	194	688	6.2e-144	0.9841269841269841
CBM67	2	153	7.9e-18	0.8181818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.31e-104	296	628	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.66e-35	25	184	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	4.08e-26	194	272	4	84	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNF26773.1	1.90e-149	4	671	134	845
QIN81509.1	8.28e-149	15	677	156	845
ASU32381.1	2.82e-146	6	680	144	850
AEI42913.1	6.87e-146	2	684	80	796
AFC30614.1	1.59e-145	2	689	125	846

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	2.79e-123	27	677	316	980	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	4.23e-98	15	669	177	876	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	2.05e-97	17	632	134	779	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3CIH_A	2.13e-13	69	687	56	691	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	1.17e-122	27	677	316	980	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	6.18e-118	7	690	167	877	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	8.78e-115	18	711	174	899	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	4.26e-55	17	703	187	918	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003584_00190.