CAZyme Information: MGYG000003584_01400

Basic Information

• Species: HGM11412 sp900770185
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; HGM11412; HGM11412 sp900770185
• CAZyme ID: MGYG000003584_01400
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
776		88038.39	6.0392

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003584	1810421	MAG	Fiji	Oceania

• Gene Location: Start: 207493; End: 209823 Strand: +

Full Sequence      

MREVIDFDKNWLFHKGDINYPEPQNKGAMYIGAKTERYHIGPASRFYYANPDSYDLNVEF
KPEKWESVDLPHDYIIGGEMSENNNNALGFFKYENAWYIKRFSLQKVDENKRITLLFEGV
ATHATVYLNGCLLKHNFCGYTTFEVDITDYAKFDEENVLSVYVQTDEHEGWWYEGAGIYR
HVKMIKTELVSVDLWGLYVCPVFDGKNWTVKTELTLRNDSYSPKTAEIITRIADLSGKIL
TKTNSFADIATKDLTTVKYDLSAENPKLWSPDEPNLYVATAQIYIGGELFDEYSTRFGFR
YFKADPNKGFFINGKNYKIKGLCGHADFGLTGKAVSDNIHRYKVSLMKEMGANGYRTSHY
PQAEALMDALDEKGFIVMDETRWFDSTIEGLEQLKMLVKRDRNRPSVFFWSVGNEEPHHV
TEEGRRICKTMTALVRKLDNSRLVLTAVSYPPNKATVYDELDVAGINYNWATYDEVRKNY
PNKMIISSENCATGTTRGWYAENDDNYAYVSAYDHDSTDDGFWAREKTWKFIMERDYVAG
GYQWIAFEHRGEAVWPRICSQSGAIDLFMQKKDAFYQNKSLWSKKPMIHLLPHWNFAGLE
GTPIKVFAYTNLPSAELFLNGASLGKANIEPYGHAEWLVNYAPGTIKAVGYGKNGEILAT
DEKITSGKGEKLAFMLETPDATANGKDVALFSCYVVDCSGLPVYDACPTVYFSASGSGRV
LATGSDVSDHTSVFLPVRRMREGRIGIAVKLSDNHGKCTLTGRADGLKTGVIIVEF

Enzyme Prediction     

No EC number prediction in MGYG000003584_01400.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	558	9.4e-93	0.589095744680851

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	4.29e-54	95	470	66	475	beta-D-glucuronidase; Provisional
COG3250	LacZ	1.12e-48	1	598	9	617	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	3.00e-36	98	444	113	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	5.17e-26	307	489	5	209	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam16355	DUF4982	5.19e-19	601	661	1	62	Domain of unknown function (DUF4982). This family is found in the C-terminal of uncharacterized proteins and beta-galactosidases around 680 residues in length from various Bacteroides species. The function of this protein is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYY34329.1	3.13e-277	1	775	1	775
QUI24688.1	4.93e-183	1	775	1	758
ANE47110.1	1.18e-172	2	734	17	747
AZK45303.1	5.59e-160	1	768	1	759
QTH40778.1	3.82e-153	1	775	1	799

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7CWD_A	1.47e-110	60	774	28	799	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	1.43e-108	57	769	31	800	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
5T98_A	1.01e-107	5	769	28	813	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
3GM8_A	7.54e-103	3	775	5	797	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
6B6L_A	1.68e-101	7	774	10	775	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	2.37e-111	2	775	42	847	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	6.21e-80	34	700	43	742	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KN75	6.76e-58	38	768	29	787	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
T2KPJ7	9.83e-55	55	750	69	799	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	1.80e-45	2	721	3	694	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003584_01400.