CAZyme Information: MGYG000003681_00230

Basic Information

• Species: Bacteroides stercoris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides stercoris
• CAZyme ID: MGYG000003681_00230
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323	MGYG000003681_1|CGC5	36310.55	7.9689

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003681	3833391	Isolate	China	Asia

• Gene Location: Start: 292514; End: 293485 Strand: -

Full Sequence      

MIAKVTMKALCSFIIALLCGVGSLSAAQQWKDTIVVARDGTGDYRTLTEAMEGIRAFMDY
KVTVLVKKGVYKEKVILPSWLENVDFIGENVENTIITYDDHANINKMGTFRTYTLKVEGS
SITFKNLTIENNAARLGQAVALHTEGDRLVFINCRFLGNQDTIYTGAKGTRLCFLNCYIE
GTTDFIFGPSTALFHNCTIHSKANSYITAASTPKDIEVGYVFKNCKLTAAPDVDKVYLGR
PWRPYAATVFINCEMGKHICPAGWDNWRNPENEKTARYAEYGNTGEGADNTNRVKWVKQL
TRKDVAKYEEPDYLFKICSEWKP

Enzyme Prediction     

No EC number prediction in MGYG000003681_00230.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	34	311	1.1e-100	0.9756944444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	2.63e-76	36	314	9	296	pectinesterase
pfam01095	Pectinesterase	4.62e-76	34	296	2	274	Pectinesterase.
COG4677	PemB	2.39e-66	26	311	77	399	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02432	PLN02432	2.04e-65	34	308	13	280	putative pectinesterase
PLN02682	PLN02682	1.39e-63	33	301	70	348	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ48638.1	1.67e-183	4	322	2	320
QUT45769.1	1.18e-182	7	322	1	316
QDO69178.1	9.53e-164	14	323	11	320
ALJ61263.1	1.29e-161	14	323	11	320
QUT93208.1	1.29e-161	14	323	11	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	8.59e-31	35	307	6	288	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.73e-30	34	296	9	281	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	5.32e-22	34	264	11	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.65e-21	34	264	11	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GXA1	6.21e-40	31	314	255	551	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9FM79	2.46e-39	27	315	75	373	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
P41510	3.69e-39	31	309	270	559	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q9LVQ0	6.65e-39	36	308	9	290	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8GX86	7.33e-39	24	314	243	548	Probable pectinesterase/pectinesterase inhibitor 21 OS=Arabidopsis thaliana OX=3702 GN=PME21 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001162	0.995409	0.002714	0.000234	0.000229	0.000232

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003681_00230.