CAZyme Information: MGYG000003706_00723

Basic Information

• Species: An181 sp002160325
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; An181; An181 sp002160325
• CAZyme ID: MGYG000003706_00723
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1481	MGYG000003706_104|CGC1	165397.35	4.2043

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003706	1667408	MAG	Estonia	Europe

• Gene Location: Start: 23; End: 4468 Strand: +

Full Sequence      

MQSMEAAFELLDPDSNDFHFTFDVLGKSSADTQWQTLFAGVEATRLKDGHIQELKLDAAK
NLKSVRINITDIKSSGGDPWPALAEFKIFADAGAGDVEDTESIAYKKPVHTNAGQSTVSR
INDGSTVNVWSGERYPAYIDIDLEKNYNLDEIQVFTPSAGYSQYSIYTSMDGRDFDKLAE
KTSKDSCPKEGESYQAKGKEARIVRLYIEYQSESSKSLVNEVRVLGKESKTPVMETPEVV
VEDFEGSAYDVDITNEDTIEEVQGIVERQIGAEYVDWFTFELADADNGYDYFDISQNGDK
IHIKGNDGVSLATGLNHYLKYFCNVNISQVGDQVKMPKEIVPVQGTIHKETKFPVRYSYN
YCTLSYSMAFWGEEEWRNELDWLALNGVNVVLDATAQEEVWRRFLGELGYTHEEAKDFIA
GPAYYAWAYMANLSGFGGPVHDNWFVERTDLARKNQLAMRKLGMQPALQGYSGMVPVDIT
DKDPSAQVIKQGTWCSFQRPSMLKTDSETFDKYAQIFYKVQKQVFGDVSDYYATDPFHEG
GNTGGMNPTVISERVLANMMQADKDAVWIIQSWQGNPTTALLQGLEGNREHALVLDLYAE
KTPHWNEQDPNAYGGGEFMDTPWVYCMLNNFGGRLGLHGHIQNFVDGVVEAADQAEHMQG
IGITPEASGNNPVLYDLFFETIWTDDADNLQKIDLDEWFKDYTTRRYGAESESAYEAMQI
LNDTVYNPQLNMKGQGAPESVVNARPKLDVSAASTWGNAVIDYDKEDLEEAARLLLSDYD
QLKGSAGYQYDLANVLEQVLSNTAQEYQKKMASAFREGDGEKFEQMSDTFLEIISKVEEV
TGTQEEFMVGTWIESAKELAKNSDDFTKDLYELNARSLITTWGSIEQANSGGLSDYSNRQ
WAGLTKDYYQPRWEKWIAERKKELAGEESKEFSLEDWFEMEWEWARANNEYPTKPNGLDL
EKLGNEILEKYSVTAIPKDPAEDDTYDIPVEGITATAGSEQAVSGSEGPASNVLDGNTST
IWHSVWSGTERENLWIDLKLQEKQMVDGVRVLPRQEGGTNGIITKYRIEVSTDGENYTKV
SEGTWNSGNGWKMAKFSPVEATNIRIYAVESLTTDSNNYASAAEIRVMAPKQETQKISTE
ILEYAIELAEKAGTQDVIPVITEEFEARLAAANTILDKVNSGDTKVTQEQVDDTWKALIN
IMQYLEFKQGDKTDLEKAIEFAESLDMNDYEDNEKMDAFLEALDAAKDVRDDENAMQDEI
DDAWKALIKATAELNRKMADMTDLNKVIEWTSALDLSKYLEEGQDTFRAALEAARDVSGD
ILSTQKEVDDAWKALMDAASALRLKPDKGALEELLETAKSYLAKEGEYAAEAFAAFRNAY
ADAAAVLGNEQASAEQVRTAQKNLGDAIVKLDRSTVSADQTAEAVANSAESKTNDLTEQS
DAAKKDTVKSAKTGDETAIFMLFLAMAGAALIAGAKLRKKN

Enzyme Prediction     

EC	3.2.1.50

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	298	961	6.7e-217	0.9849170437405732
CBM32	997	1125	2.8e-21	0.9516129032258065

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	2.36e-148	356	685	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	4.81e-92	698	957	1	251	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	3.26e-30	260	338	1	78	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.
pfam00754	F5_F8_type_C	4.18e-20	994	1125	1	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	3.26e-10	986	1121	7	136	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM12248.1	0.0	314	1342	2	1030
AMN35090.1	1.05e-241	87	1082	29	1017
ABG84150.1	5.04e-241	87	1082	20	1008
AMN32327.1	8.57e-240	87	1082	29	1017
AQW26154.1	3.24e-239	87	1082	29	1017

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MFK_A	1.70e-246	92	985	5	899	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
2VC9_A	1.84e-246	97	985	2	891	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
4A4A_A	1.53e-245	94	985	22	914	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]
4XWH_A	2.15e-91	262	971	9	711	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
4A41_A	4.59e-21	988	1129	25	161	CpGH89CBM32-5,from Clostridium perfringens, in complex with galactose [Clostridium perfringens],4A44_A CpGH89CBM32-5, from Clostridium perfringens, in complex with the Tn Antigen [Clostridium perfringens],4A45_A CpGH89CBM32-5, from Clostridium perfringens, in complex with GalNAc- beta-1,3-galactose [Clostridium perfringens],4AAX_A CpGH89CBM32-5, from Clostridium perfringens, in complex with N- acetylgalactosamine [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FNA3	2.35e-100	298	971	92	804	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1
P54802	2.00e-90	262	971	32	734	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q0TR53	1.53e-15	993	1147	629	785	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	1.53e-15	993	1147	629	785	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
P29767	3.06e-14	1007	1127	67	183	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
1458	1475