CAZyme Information: MGYG000003710_00244

Basic Information

• Species: Loigolactobacillus coryniformis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Loigolactobacillus; Loigolactobacillus coryniformis
• CAZyme ID: MGYG000003710_00244
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
223	MGYG000003710_13|CGC1	24801.51	9.9388

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003710	2331695	MAG	Russia	Europe

• Gene Location: Start: 6099; End: 6770 Strand: -

Full Sequence      

MQKVAMKKVGVCVAKKRKKGNLFKQLGLPQLILAGIIIAFVGLLLVRLFGEQPRVAVDDS
AAVTQESIQREHRAFITKLAPVAQRLQLTYHVLPSVTIAQAILESNWGTSQLATRYHNLF
GVKGTDPNTSQILTTKEYQNGKWIEINARFQVYSSDTAALEAHAKLLAQGTTWNPQQYQH
VVAATDYKTAAAALQQDGYATDPTYAQKLINVIETYKLNQYDQ

Enzyme Prediction     

No EC number prediction in MGYG000003710_00244.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	80	218	4.2e-38	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.87e-70	36	223	9	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	2.15e-39	72	222	8	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK08581	PRK08581	8.62e-39	73	222	321	472	amidase domain-containing protein.
NF038016	sporang_Gsm	1.02e-29	74	222	162	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK05684	flgJ	3.17e-29	45	217	132	298	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATO44600.1	3.35e-144	13	223	1	211
ATO56378.1	3.35e-144	13	223	1	211
QEA54436.1	5.55e-143	13	223	1	211
SFZ87315.1	3.02e-111	13	223	1	214
ANK69524.1	1.16e-86	13	223	1	210

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.47e-29	51	222	6	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	1.34e-21	48	222	36	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	1.30e-19	71	217	2	149	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.84e-19	71	217	2	149	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	7.53e-18	73	220	2	150	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	2.59e-42	71	223	47	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9CIT4	6.73e-24	74	222	64	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	3.27e-23	75	222	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	3.27e-23	74	222	64	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
P39046	7.29e-22	52	222	43	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999917	0.000134	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
26	48