CAZyme Information: MGYG000003731_00687

Basic Information

• Species: Prevotella amnii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella amnii
• CAZyme ID: MGYG000003731_00687
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
706		81760.14	8.9919

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003731	1790835	MAG	Canada	North America

• Gene Location: Start: 19027; End: 21147 Strand: +

Full Sequence      

MKYNKRILFSAVLLLMFFNLTIAQDMIPKPNSYTPLKGSFSWDSDVIVYINADHSDANRL
KHYIKEVFGFTKILKHSSKHLLKSCAKGCFEDNKKTLTLTCTNKANLPKGYLPTQQQQGY
NIQIDAKHISVTAPTACGLFYALQTLRQLTTNGKIQCATITDSPRFMYRGLQLDCSRHFW
TKDFIKKQLDAMAYFKLNVFHWHLVDGGGWRLQIKKYPRLVRETAYRTYSSWDKWRKEDE
RGFAHKQDPNAYGGYYTQEDVKEIVRYASDRHIEIIPEIEMPGHSEEVTFAYPELSCSKK
NNSHEDLCPSDERTYVFMTNVLKEVFKLFPSKYIHIGGDEAMRSTWETCERCQKKMRELQ
LTSTAQLQSYFTHRIEQFLNKNDRKLIGWDEIMEGELAPNAAVTSWRGEQYGLKAAKLGH
KVVMSPVGYCYIDMFQDAPNTQPKAQGGYLPLRRIYSYDPVPKQYKGTQVESNIIGLQAC
LWTEYVEDSAHAEYMIYPRVLAIAETGWAAQKEDYNKFRVRAITAVDTLKSWGFNPFDLA
NEKGVRTQARKIYKHDARDKNIIYNAPYAEKYRAEGDSTLVNGKAGDWGYIEGGWQGFIN
GFDVVIDFGKDIDISSVKADFLHINTVWIFTPNEIELSVSSDNKIFTTIDKRDPNIKKEQ
VYYIYPYNWKGQAKGRYLRLKAKGNIIGGWIFTDEIRVNEEKYKNN

Enzyme Prediction     

No EC number prediction in MGYG000003731_00687.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	161	510	5.1e-116	0.973293768545994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06563	GH20_chitobiase-like	0.0	166	522	1	357	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	6.59e-147	166	510	1	345	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	6.63e-114	107	536	196	644	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06568	GH20_SpHex_like	4.99e-94	166	521	1	328	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.
cd06570	GH20_chitobiase-like_1	3.14e-89	166	511	1	299	A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This subgroup lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB64622.1	2.01e-278	4	701	2	691
QUB60677.1	1.63e-277	4	701	2	691
QUB59920.1	2.09e-277	4	701	2	698
QUB57261.1	2.09e-277	4	701	2	698
QKH87977.1	9.36e-277	4	701	2	691

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q63_A	2.43e-116	115	699	103	774	BT0459[Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]
6EZR_A	3.55e-83	19	535	135	636	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZR_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZS_A Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6EZS_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6K35_A Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi],6K35_B Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi]
7CBN_A	1.72e-82	79	535	40	509	Crystalstructure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila [Akkermansia muciniphila ATCC BAA-835],7CBO_A Crystal structure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila in complex with GlcNAc [Akkermansia muciniphila ATCC BAA-835]
6EZT_A	4.74e-82	19	535	132	633	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi],6EZT_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi]
7DUP_A	3.15e-81	104	534	65	520	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_A Chain A, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49008	1.00e-104	116	535	109	531	Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=nahA PE=3 SV=2
B2UQG6	1.25e-81	79	535	59	528	Beta-hexosaminidase Amuc_0868 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0868 PE=1 SV=1
P96155	3.26e-76	113	507	203	604	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1
B2UP57	1.64e-62	112	509	52	448	Beta-hexosaminidase Amuc_2018 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2018 PE=1 SV=1
Q7WUL4	4.68e-48	118	521	82	462	Beta-N-acetylhexosaminidase OS=Cellulomonas fimi OX=1708 GN=hex20 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000328	0.999006	0.000195	0.000169	0.000154	0.000143

TMHMM  Annotations     

start	end
7	24