CAZyme Information: MGYG000003772_00646

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Negativicoccaceae
• CAZyme ID: MGYG000003772_00646
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A/1B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256		28282.07	4.744

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003772	1021183	MAG	Canada	North America

• Gene Location: Start: 4945; End: 5715 Strand: -

Full Sequence      

MTKLLILALLVGGAYYWWTDPAVPTADSSRGASPAVAASDTLTLDDVREQYRRWTAFREN
FESHLDRKGFTASDDIPLLLRQAIVATEDRRFYEHGAVDLMSIGRAMLANYQAGDVEEGA
STITQQVIKNVLLTDERTWLRKGQEILLASQMERVYTKDEILDIYLNTIYYGSGATGIGE
AARVYFDTTPERLTLAQCAMLAGLPQAPSARNPFSDYDAAKARQKTVLVLMTRQGMISPT
TADKAYAEDLGLAVAP

Enzyme Prediction     

No EC number prediction in MGYG000003772_00646.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	70	231	8.5e-63	0.9096045197740112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	2.77e-84	74	232	19	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	2.87e-80	74	250	8	184	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.34e-77	1	256	20	265	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	4.36e-71	4	252	15	251	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	4.70e-52	74	250	72	248	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIF50162.1	2.39e-70	30	253	28	253
AJQ29176.1	7.76e-69	3	253	5	253
AXB81629.1	2.29e-66	26	252	23	256
ARF99932.1	2.94e-66	3	252	9	265
AVO26612.1	3.67e-66	27	252	24	262

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	1.60e-45	65	245	17	197	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	2.27e-45	65	245	17	197	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3DWK_A	1.74e-38	75	250	34	209	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	3.93e-37	75	250	43	218	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3UDF_A	3.20e-36	76	252	47	223	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O87626	1.33e-49	19	250	31	250	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
P39793	2.68e-48	35	245	57	273	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
O05131	3.22e-48	19	250	31	250	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae OX=485 GN=mrcA PE=1 SV=3
P0A0Z6	3.22e-48	19	250	31	250	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1
P0A0Z5	3.22e-48	19	250	31	250	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.203049	0.785988	0.009735	0.000420	0.000346	0.000442

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003772_00646.