CAZyme Information: MGYG000003872_00999

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Clostridium_A
• CAZyme ID: MGYG000003872_00999
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
196		21990.69	4.3996

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003872	2901403	MAG	United States	North America

• Gene Location: Start: 5765; End: 6355 Strand: +

Full Sequence      

MSKSAKKGLLALLMLAVLAAAAAGAYFSYSFFIKQAYPRKYADIIETQAEKYNIDPAFLY
GVIRTESNFDPGAQSSAGAMGLMQIMPATFDWLQTHKGTEPKLDASALYDPQTNVEYGAY
FLSILEEEYDDETVILSAYNAGMGNVDQWLSEKEHSADGVTLHDIPYGETEQYVKNVLES
QAMYHRLYDGEFKNWR

Enzyme Prediction     

No EC number prediction in MGYG000003872_00999.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	43	182	1.1e-31	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	3.01e-66	38	181	1	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.84e-55	36	187	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.83e-37	56	182	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	2.02e-32	36	190	134	289	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16893	LT_MltC_MltE	2.66e-32	43	181	1	161	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEY33915.1	7.63e-51	29	188	29	188
CAB1248982.1	2.75e-48	29	188	36	195
CDZ23581.1	2.11e-46	28	190	28	190
QNO16977.1	6.44e-46	36	188	54	208
CAB1246558.1	1.25e-45	36	191	49	204

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	7.84e-23	37	188	412	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	7.88e-23	37	188	416	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	7.93e-23	37	188	422	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	7.97e-23	37	188	426	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	8.02e-23	37	188	432	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	3.95e-19	33	191	472	631	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	3.95e-19	33	191	472	631	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	1.83e-18	33	191	472	631	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31608	2.30e-18	45	177	64	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	7.38e-18	36	182	1417	1542	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.761527	0.209743	0.013905	0.002066	0.000899	0.011866

TMHMM  Annotations     

start	end
10	32