CAZyme Information: MGYG000003948_00013

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes
• CAZyme ID: MGYG000003948_00013
• CAZy Family: CE1
• CAZyme Description: putative protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272		30405.57	6.7692

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003948	2150232	MAG	United Kingdom	Europe

• Gene Location: Start: 16931; End: 17749 Strand: -

Full Sequence      

MKRILFLLTAVAICASASAFTRHELAVRSEAMDKNVPVIVLLPDGYASADRLPVVYLLHG
YSDNHKAWDAKGGAGAMADLYGTIIVTPDGGFDSWYFDSPVDPTYRYETFVTRELIPYID
KLYKTVADRSGRAIAGLSMGGHGALYLAIRHQDLFAAAGSMSGGVDIRPFPNNWGMSKRL
GTIDEHPDNWERNTVINMTDRLRPDSLKIVFECGTDDFFLGVNRALHEKLLKEGIPHDFY
ERPGGHNWAYWSNAVQYQMLFFSNAFKAGKKE

Enzyme Prediction     

No EC number prediction in MGYG000003948_00013.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	29	258	7.3e-63	0.960352422907489

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	6.60e-48	42	268	41	314	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	2.15e-43	29	251	1	235	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	4.45e-29	39	254	85	287	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
PLN02442	PLN02442	5.91e-12	47	241	42	242	S-formylglutathione hydrolase
COG2819	YbbA	4.86e-09	40	163	27	170	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV69022.1	8.18e-25	23	264	47	281
ADV60895.1	1.43e-23	43	262	159	385
BBB44341.1	1.52e-23	28	246	123	365
QSM89135.1	3.52e-23	28	246	180	422
AWG67714.1	4.23e-23	28	246	129	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	1.48e-31	29	262	19	267	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
4RGY_A	1.71e-20	53	256	44	255	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
1JJF_A	5.80e-19	29	251	39	246	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	1.53e-18	29	251	39	246	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]
7B5V_A	1.53e-18	40	262	157	385	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WM38	4.39e-22	28	246	180	425	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1
P9WM39	4.39e-22	28	246	180	425	Esterase Rv1288 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1288 PE=1 SV=1
P23553	8.12e-18	29	255	10	254	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
P10478	2.32e-17	29	251	58	265	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P0C1D6	4.31e-16	11	265	93	385	Protein PS1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=csp1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000503	0.998730	0.000259	0.000175	0.000157	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003948_00013.