CAZyme Information: MGYG000004003_03004

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004003_03004
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
783		86075.34	5.827

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004003	5653807	MAG	United Kingdom	Europe

• Gene Location: Start: 14915; End: 17266 Strand: -

Full Sequence      

MLNGICKLLLLATIVMEGTCAFAQLSAESYKNPRLPVEQRVADLLSRMTLEEKVGQLLCP
LGWEMYGIEGEAVFPSDKFKQLIKERHAGMLWATYRADPWTRKTLENGLNPALAAKAGNS
LQKYVMENTRLGIPLFLAEEAPHGHMAIGTTVFPTGIGMAATWSPQLINEVGKTIGKEVR
LQGGHISYGPVLDLTRDSRWSRVEETFGEDPVLTGTMGKAMVEGLGGGNLSQPYSTLATL
KHFLAYGISESGQNGNPSLVGIRELHENFLPPFRRAIDAGALSVMTSYNSMDGIPCTANH
YLLTRLLRNEWKFKGFVVSDLYSIEGIHQSHFVAPTMEEAAILALSAGVDVDLGGDAYMN
IINAVNTGRISNAVLDASVACVLRLKFEMGLFENPYTDPEKAKKEVRNNAHITLARRVAQ
ASVTLLKNEHSLLPLNKDISRIALVGPNADNRYNMLGDYTAPQEEENVKTVLDGICAKLS
PTQVEYVKGCAVRDTTTSNLEQAVAAARRSEVIIAVVGGSSARDFKTSYKETGAAIADEK
TVSDMECGEGFDRTTLSLLGKQQELLKALKATGKPLVVVYIEGRPLDKNWASENADALLT
AYYPGQEGGNAIADVLFGDYNPAGRLPITVPRSVGQIPIYYNKKAPQKHDYVELSASPLY
PFGYGLSYTTFEYSDLYLSAITPHSFEVSFKVRNTGECDGEEVAQLYLRDEYASVVQPLK
QLKHFERFYLKRGEMKEVKFILSESDFALIDRDLKTVVEPGTFQIMVGASSDDIRLQTKV
EIK

Enzyme Prediction     

No EC number prediction in MGYG000004003_03004.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	126	353	1.9e-70	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	2	778	1	761	beta-glucosidase BglX.
COG1472	BglX	8.84e-93	48	461	1	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	5.94e-91	20	768	32	769	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	4.31e-76	49	385	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	3.13e-71	423	668	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU94137.1	0.0	1	783	1	783
QRN02118.1	0.0	24	783	11	769
QNL40717.1	0.0	1	783	1	783
QNL37005.1	0.0	24	783	23	782
QGT74048.1	0.0	7	783	4	782

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	3.54e-148	30	775	7	749	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	2.76e-147	30	775	7	749	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	5.32e-146	1	782	8	784	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
6R5I_A	1.36e-141	38	771	4	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	2.39e-141	28	771	26	754	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	4.30e-142	41	775	38	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	3.65e-140	25	775	19	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	1.11e-135	7	783	2	755	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
T2KMH0	1.89e-134	128	775	60	716	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q23892	3.42e-91	41	777	80	821	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000223	0.999171	0.000148	0.000158	0.000135	0.000128

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004003_03004.