CAZyme Information: MGYG000004108_00916

Basic Information

• Species: UMGS1387 sp900551295
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-382; UMGS1387; UMGS1387 sp900551295
• CAZyme ID: MGYG000004108_00916
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
783		88107.88	5.1596

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004108	2373167	MAG	United Kingdom	Europe

• Gene Location: Start: 47543; End: 49894 Strand: -

Full Sequence      

MFSKNFYGAGKEYCTYDKHVNAPYLRRTFELDKIPETASLKITSSGFYELYINGEKITKC
PLSPYITNPDSVLVYDTYDLIPYLKSGENCIGIILGNGLVNCLGGFIWDFEKAPYRAAPS
AAFYFEAKNGDKTVLSFEADENIKTHPSPILFDDLRSGVIYDARLEIPDWCKPGFDDKDW
TPAIKADTLRGEPVDFDTDKLSFSEILDAVSFEQGKEQEVQIPSCKRPMPPSVPVMENDK
QGYVYDFGKNSAGIPIFKIKGKPGQMIALQFSEYFRGGVYSYENINRFYPDGYTQRDYYI
CRGDGSEETFMPPFTYHGAQYCTVIGAEKEQLDIDTVKFCVIHSDFVSRGDFDCSDRIAS
ELQKAVRRSDLANFVYFPTDCPHREKNGWTGDASMSAEQFTLNFGVEKSLKFWMRLIRQS
QRIDGAIAGIVPTSGWGYAWGNGPIWDSVIVELPYQTYKYRGDISMFKENADMVLRYLHY
AAKKRNKRGLCAFGLTDWVQPGYDSANPTTPQVVTDTFMLVNICRKAGIMFAAAGLKAES
DYAYSLMNEYRNAAREYLVDLNTMTALGETQCAQSAAIYYEIFDKAEIPEAGRRLVEIVH
RANDVFDCGMLGVRLVFNVLADLGYADLAYKMITRSDVRGYGIWIEKFGISTLPESFHDT
IDGFTTSLDHHFLGDISDFFITKIAGIRVNPKLDDANYVEIRPNFVKTLDSACAHYDTVS
GKVSVSWKRSPDGTVSVSVDKPCAVRVNLFLPKGFVCTTPGFYRGKSALLNFSGVTDAKE
YAL

Enzyme Prediction     

No EC number prediction in MGYG000004108_00916.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	237	749	1e-113	0.9900793650793651
CBM67	18	189	1.2e-26	0.9034090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.26e-60	350	680	4	336	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	5.46e-34	33	197	1	164	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	9.39e-17	243	343	8	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	5.54e-08	698	752	11	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYB33152.1	1.49e-122	15	754	177	879
QGQ94103.1	6.77e-122	17	755	138	844
QGA24212.1	5.74e-113	22	756	156	865
QNN24933.1	1.37e-111	22	729	352	1033
BCI64545.1	8.64e-111	8	753	150	858

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.31e-74	22	755	176	902	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	9.09e-52	22	735	302	979	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	2.45e-51	26	727	135	816	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	6.27e-66	22	751	184	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	1.13e-60	17	728	168	856	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	3.46e-53	24	739	172	868	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	4.79e-51	22	735	302	979	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004108_00916.