CAZyme Information: MGYG000004131_01135

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1484
• CAZyme ID: MGYG000004131_01135
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
554		61870.88	5.7145

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004131	1840905	MAG	United Kingdom	Europe

• Gene Location: Start: 50703; End: 52367 Strand: -

Full Sequence      

MSIIDSFDFLEKDERVRKYILPEKIAGLGGNVKNPEALLKAKTLQIGLNETDVTELSNDG
DGQNAFVVLDFGKELHGGIRLLNFVSEITAYPKVRLTFGESLCEAMSLIGQKGACNDHAV
RDFEIPVPSYSDQEWGQTGFRFVKIELTEPKAKIAIKAAPAVFIYRELEYKGSFCCDDED
VNRIFDTAAYTCHLNLQNMVWDGIKRDRLVWIGDVHPEMLTARTIFGPLGLINKSLEFAR
SQAPLPLYMNGMASYSMWWLIIAWDYYFYSGDSSLLTGQKEYVLSLLRLFCGKVNDDGSD
SVGNYFLDWPTHQKELSEKSGVRALLKIALEKGALISEFLNDGRLCEICRNKAEKISKIP
GDHEGQKQTAAFMSAAGLMKKEQAAEVIKKNGSDGISSYLLFYTLKELADTDEISALNIL
KKYSLGMLQRGATTFWEDYDPLWAKNTGSITDLPKDGQDDIHGDRGDYCYKGFRHSLCHG
WASGAVPFLMEQVAGIHIIGAGCRKIEIKPKMGNLKFIKASYPTPYGVLELSIENKNGRP
KINFSAPDGVEIII

Enzyme Prediction     

No EC number prediction in MGYG000004131_01135.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	67	552	1.5e-79	0.9742063492063492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.59e-13	172	471	4	338	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	5.51e-05	495	551	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBE16159.1	7.00e-159	16	554	39	584
ATP57578.1	5.27e-155	17	553	41	583
QGQ98689.1	7.83e-154	12	553	9	557
QZE13938.1	1.43e-153	17	553	25	566
QNL50446.1	2.47e-152	12	553	35	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	3.30e-38	67	541	194	684	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6GSZ_A	1.60e-11	55	528	316	811	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
4XHC_A	2.68e-07	67	491	95	540	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004131_01135.