CAZyme Information: MGYG000004150_02788

Basic Information

• Species: Comamonas kerstersii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Comamonas; Comamonas kerstersii
• CAZyme ID: MGYG000004150_02788
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
441	MGYG000004150_17|CGC1	50019.75	9.7223

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004150	3434704	MAG	United Kingdom	Europe

• Gene Location: Start: 51538; End: 52863 Strand: +

Full Sequence      

MMWEQFIAEFQALMLSSSAQGFDALAVAFPIIVLLELPFYVLVIIGMLRFGLRRWKRRAP
SSYYPSVSCLVTCYSEGEDVRKTISTLVNQRYAGHIQIIPIIDGAIKNHLTLQAAHSEAQ
RWRDQPFREVMVLPKWQRGGRVSSLNAALPFATGEVLMALDGDTSFDNDMVEKATRHFED
PQVAGVAGNLRVRNQNKSLVAKMQGLEYVLSISGGKTGLSEFNVVNNISGAFGVFRASIV
RLVGGWDAGSAEDLDLTLRIKQYFGRHAGMKIKFEPHAVGHTDAPDTWRVFAKQRERWDG
DMFYIFIRKFRFNLRPSLLGWPNFLFTLVNGILMQLILPFLIVIALIAALVMQPLVVVLA
KLAVLYSFYLFVLGIFYIVYLAAVSERVWFDCKYLPYLPLFPIFASLLRIYSVYCILVEI
FTKSHLDSSMAPTWVLKKNKF

Enzyme Prediction     

No EC number prediction in MGYG000004150_02788.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	65	298	2.9e-21	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	6.87e-44	70	253	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	7.38e-39	27	418	12	401	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	4.26e-34	44	371	26	342	N-glycosyltransferase; Provisional
cd04190	Chitin_synth_C	1.37e-21	69	298	1	237	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
cd06439	CESA_like_1	1.31e-20	40	297	5	243	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOQ81987.1	3.31e-214	2	441	1	441
BCX51050.1	6.67e-214	2	441	1	441
ACY35141.1	3.84e-213	2	441	1	441
ART52868.1	1.89e-182	2	441	1	441
AYM97554.1	2.37e-178	2	441	1	441

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YV7_B	5.22e-07	53	187	25	161	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	5.23e-07	53	187	26	162	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GLC5	9.68e-22	67	332	49	301	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q5HKQ0	3.25e-21	67	310	49	279	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1
Q7A351	1.47e-20	67	310	49	279	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1
Q6GDD8	1.47e-20	67	310	49	279	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q5HCN1	1.47e-20	67	310	49	279	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000020	0.000024	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
26	48
312	334
338	360
362	384
399	421