CAZyme Information: MGYG000004176_01110

Basic Information

• Species: Pradoshia sp001183965
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-1321; Pradoshia; Pradoshia sp001183965
• CAZyme ID: MGYG000004176_01110
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
302		34436.2	7.0093

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004176	2444221	MAG	United Kingdom	Europe

• Gene Location: Start: 167; End: 1075 Strand: +

Full Sequence      

MQPKVCTIIVNYNGTEDTIACLESLSKATYSNHTAVIVDNASKETSSLKNYVEDAGFHFL
GLKENGGFAAGNNNGIRYALECIADIDYFLLLNNDTEVDPHFIEPLVEECEKDPQVGACG
SHINYYANRDETWFGGGDIKWLTGRVLHKTRERGKGEPSDENFLTGCVFLFPVSMLDKAG
FLDEDYFLYYEDAAYSLEIRKAGYRLRYVPQSLVYHKVSATTGYRSPLSNYYGTRNNLLF
MSLYAKKPVFLMFLLYFFVKNTVKYIWYIGKGKQFKRVSLAIKKAFYDFATAVSGKREYP
FM

Enzyme Prediction     

No EC number prediction in MGYG000004176_01110.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	7	176	7.3e-20	0.9647058823529412

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	1.72e-60	1	299	1	300	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	4.32e-52	7	218	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02526	GT2_RfbF_like	3.96e-26	8	236	2	232	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
cd04185	GT_2_like_b	8.08e-26	8	240	2	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	1.61e-16	8	176	3	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFK70593.1	3.56e-168	1	302	4	305
BCZ47099.1	1.27e-59	2	276	1	281
ABU56590.1	6.69e-58	1	241	4	245
ADK13607.1	1.54e-57	1	286	2	291
AYD39334.1	4.33e-57	2	276	1	280

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HCN1	2.51e-09	8	223	52	258	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q6GDD8	2.51e-09	8	223	52	258	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q7A351	2.51e-09	8	223	52	258	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1
Q99QX3	2.51e-09	8	223	52	258	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=icaA PE=3 SV=1
Q9RQP9	2.51e-09	8	223	52	258	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
248	270