CAZyme Information: MGYG000004223_02121

Basic Information

• Species: UMGS1883 sp900763305
• Lineage: Bacteria; Firmicutes_A; Clostridia; UMGS1883; UMGS1883; UMGS1883; UMGS1883 sp900763305
• CAZyme ID: MGYG000004223_02121
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393		45161.94	5.4971

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004223	2575981	MAG	United Kingdom	Europe

• Gene Location: Start: 141; End: 1322 Strand: +

Full Sequence      

MKTSLDYGKECCDALMKRYKPEKLPPEGSLFYIQGVFLSGMQHIYSLSGDEKYFNYVKAY
VDSTIGKNGELYGFCHELPIPAVAEKTRRALTMLDFKQPAVLMYQLYDKTGEEKYRRVIE
TIAESMYFWPVNRYGGYWHMMTQPFQMWMDGAYMAGPLSVMYAARFGGDILRDRAIRQIF
IMNDFMKDKKTGLYYHGWDDSAAIQGFSPMPWADPVTGLSSQIWGRAVGWYAVAILDMLD
YIPKDHPDVPRLKKIECDLLVALPAFQDEKTGMWYNVLDKPGKKGNWVESSCTSLFIYSY
AKALRTGILDEKYAPVLEKAYSGLCDSLYYDENGDLTVDNICIGTCIDEGTYEHYIGRER
LKNDLHGAGAFIMMCAEMQRLTEQMKREKSDEI

Enzyme Prediction     

No EC number prediction in MGYG000004223_02121.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	25	380	6.8e-94	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	7.27e-88	2	381	6	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.31e-86	12	381	6	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ93957.1	2.49e-117	2	378	7	360
QNK55786.1	3.41e-117	1	378	7	360
QAY65767.1	9.85e-117	3	380	17	370
AIQ46562.1	2.01e-116	3	378	8	359
AIQ52128.1	3.05e-116	3	378	8	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NC5_A	4.61e-88	1	381	10	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.71e-87	2	381	1	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	1.75e-57	32	381	25	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3K11_A	5.82e-13	147	391	199	423	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4XUV_A	4.53e-12	32	345	49	337	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	2.52e-87	1	381	10	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	6.46e-22	154	377	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	6.46e-22	154	377	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	3.45e-13	35	347	34	305	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004223_02121.