CAZyme Information: MGYG000004282_01912

Basic Information

• Species: Ruminococcus_D sp000434695
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_D; Ruminococcus_D sp000434695
• CAZyme ID: MGYG000004282_01912
• CAZy Family: GH5
• CAZyme Description: Cellulase/esterase CelE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388		43358.34	4.3562

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004282	2340138	MAG	China	Asia

• Gene Location: Start: 50279; End: 51445 Strand: +

Full Sequence      

MAVMKRIMAAAAAAALCASMAACGSKNESSSNGGDKKTESGSAGTMRDISSMDLVKEMKL
GYNLGNSLDVCNADRDGDGVANETADKVDETLWGNPTVTKEQLEFVKNSGFDSVRIPVTW
RDHMNDEYVIDADWMDRVQEVVDYAYDLDMYVIINIHHDGGGDPDFGAWVRNASTDYEGV
EARYVKVWEQICDRFKNYGDKLIFESMNEVGFDDMAEDAAYETLNKLNQKFVDTVRASGG
NNDKRHLLIAGYWTDIERTCNEKYKLPSDPADRCIVSVHYYTPWEFCTTTNQHDWGTDAE
VSLMKSKVEQLKTTFVDKGIPVIVGEYGTCYGNDEASRVKFCEDFVSFCTEAGIPTYIWD
DGGLFLRADMKWQNEDIINGIKKAAGAK

Enzyme Prediction     

No EC number prediction in MGYG000004282_01912.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	90	362	5.6e-102	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	2.17e-58	76	360	2	267	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	8.86e-31	38	383	30	381	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO05659.1	5.11e-175	44	388	45	390
CBK96026.1	1.57e-142	43	388	92	443
CBL35063.1	1.58e-140	43	388	137	488
CBL17363.1	3.25e-101	39	382	24	371
QQA02033.1	2.50e-92	43	362	37	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XSU_A	2.90e-74	48	386	10	354	GH5-4broad specificity endoglucanase from Ruminococcus flavefaciens [Ruminococcus flavefaciens],6XSU_B GH5-4 broad specificity endoglucanase from Ruminococcus flavefaciens [Ruminococcus flavefaciens]
4IM4_A	1.00e-72	46	386	2	336	ChainA, Endoglucanase E [Acetivibrio thermocellus],4IM4_B Chain B, Endoglucanase E [Acetivibrio thermocellus],4IM4_C Chain C, Endoglucanase E [Acetivibrio thermocellus],4IM4_D Chain D, Endoglucanase E [Acetivibrio thermocellus],4IM4_E Chain E, Endoglucanase E [Acetivibrio thermocellus],4IM4_F Chain F, Endoglucanase E [Acetivibrio thermocellus]
6XRK_A	2.37e-71	50	386	23	373	GH5-4broad specificity endoglucanase from an uncultured bovine rumen ciliate [uncultured bovine rumen ciliate],6XRK_B GH5-4 broad specificity endoglucanase from an uncultured bovine rumen ciliate [uncultured bovine rumen ciliate]
6GL2_A	3.99e-69	44	383	7	337	Structureof ZgEngAGH5_4 wild type at 1.2 Angstrom resolution [Zobellia galactanivorans]
6MQ4_A	2.49e-68	46	386	7	350	ChainA, cellulase [Acetivibrio cellulolyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P28621	1.81e-71	46	387	37	376	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
P23660	3.35e-68	43	381	19	359	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
P10477	7.80e-68	46	388	52	388	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
P28623	1.28e-64	46	386	38	373	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
O08342	3.91e-62	42	381	31	395	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000039	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004282_01912.