CAZyme Information: MGYG000004310_00583

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA10281
• CAZyme ID: MGYG000004310_00583
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
854		97953.71	5.6145

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004310	2112592	MAG	Israel	Asia

• Gene Location: Start: 25934; End: 28498 Strand: +

Full Sequence      

MRVSFRRFSKAAEGLPEITANMLRIINFKTEYRSNPLGIDNKKPRFSWQFSENAEIESYR
ITVYGDEKSVKENNPDVWDSEWLPFKDVFEIEYNGAPLKSHSRYFVTAEVKDKAGKIYSG
DVETFETALFDIEDWKGKWVAIPVNFNGGTLLFRKKITLPTDKKIKRARAYICGIGYHEF
FLNGKKIGDEVLNPSVTEYAERVEYCVYPMDDLLPGDNVVGVELGYGWFGARKLNAQFYV
EFEDGTYFEDHSGPGNGWWVGGSPTIENGIYSGEVYDARIEGKYPLNWATLDYEPTWANG
WMYTIVTAAPKGKLEVQSINPIKVMRTFPEKSRTDMGGNVFVSDMGVNFAGWVRIKVKGK
RGAAVTLKFGEQLDGKGYVNQLNLRSARCSDKYILKGEGVEEYAPRFTYHGFRFVQCEIE
GNAELIEITGEHVHSSCETVGSFACSDETLNRLHEIAVLTEQNNEHSILTDCPQRDERFG
WLNDLGSRVYQTIYNIDMSRFFPKFTRDITHSQTAKGEIADTVPFYTGGVPADPVCVIYL
LMATYCYRYYGDKSVCENEYEHLKAWVEYLKSRSADYIMDYYYYGDWVLPYPDKVQPDNI
FVSTTYLHWHLKEMKKIAEIVGNKEDIKLYEKDIELSRKAINAKYFDEKTCNYSRGTQSE
NAIALSLGICEEKYAEKVAKNIHADVVERNYHCTSGNVGYRHVFYMLAKYGYAEDVIKIL
KNPEYPGWGYMIVNGATSVWERWEYGMTNEMHSFNHPMFGSYDAFLYKFLGGIDVDETAF
GANKILIEPVFVKDVDYVKTSYKTVRGLVKSEWKRNGKEIEVHLEVPPFTVASFISGSGK
KEFSAGEYNFKIAE

Enzyme Prediction     

No EC number prediction in MGYG000004310_00583.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	339	832	1.8e-140	0.9781746031746031
CBM67	148	295	2.2e-16	0.8238636363636364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.21e-90	438	768	1	338	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	9.55e-41	163	326	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	7.42e-33	336	434	3	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	5.86e-09	772	832	1	59	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA22854.1	1.34e-193	23	850	32	874
QEC51112.1	3.97e-189	23	851	69	911
VEH16339.1	1.95e-176	20	854	29	872
AEE97752.1	1.52e-167	18	832	1	844
AHF90970.1	7.52e-167	31	832	14	840

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.49e-156	19	827	26	889	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	9.54e-86	154	832	306	990	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.18e-84	23	852	2	865	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.48e-96	33	842	40	912	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	2.29e-92	35	832	46	874	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	4.40e-85	154	832	306	990	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	4.75e-81	35	852	42	910	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004310_00583.