CAZyme Information: MGYG000004319_00332

Basic Information

• Species: CAG-273 sp000438355
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-273; CAG-273 sp000438355
• CAZyme ID: MGYG000004319_00332
• CAZy Family: GT101
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
289	MGYG000004319_2|CGC1	33820.78	8.6471

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004319	1434556	MAG	Israel	Asia

• Gene Location: Start: 163589; End: 164458 Strand: +

Full Sequence      

MKISHKKQKYIGNVLKILQGFKIKSPEETIDKIINDNCSITRFGDGEFDMILGKGMKYQT
YNEQLGRRLEQVLKSNDEKLLIGINNVIDLKYSENYNDFANNFWKGWLRSNKFKLLKLLS
KNKQYYSSNITRFYIDYKDKTNVKKYVEKLRGIWDKKDILIVEGEYSRLGVGNDLFDNAN
SIERIICPSENAYDIYDKILSETKKYGENKLILLAVGPTATVLAYDLYEAGFRVIDIGHV
DIEYEWFLRKATEKIKIETKYVTEVKDGENNIQDISDEKYEKEIVSKIL

Enzyme Prediction     

No EC number prediction in MGYG000004319_00332.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT101	40	264	6.9e-89	0.9955357142857143

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08759	GT-D	1.68e-111	41	265	1	223	Glycosyltransferase GT-D fold. This domain is found at the C-terminus of proteins such as the probable glycosyltransferase Gly that also contain the glycosyl transferase domain at the N-terminus. It is also found N-terminal in numerous putative glycosyltransferases such as GalT1. GalT1 has been shown to catalyze the third step of Fap1 glycosylation. This domain is structurally distinct from all known GT folds of glycosyltransferases and contains a metal binding site. This new glycosyltransferase fold has been named GT-D.
TIGR03728	glyco_access_1	4.33e-108	23	288	1	264	glycosyltransferase, SP_1767 family. Members of this protein family are putative glycosyltransferases. Some members are found close to genes for the accessory secretory (SecA2) system, and are suggested by Partial Phylogenetic Profiling to correlate with SecA2 systems. Glycosylation, therefore, may occur in the cytosol prior to secretion.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWI12255.1	6.93e-84	23	289	36	299
ABY44566.1	9.81e-84	23	289	36	299
QWG83469.1	9.81e-84	23	289	36	299
QWH18731.1	9.81e-84	23	289	36	299
QEL86294.1	2.79e-83	23	289	36	299

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PHR_A	4.73e-64	14	288	5	276	Domainof unknown function 1792 (DUF1792) with manganese [Streptococcus parasanguinis FW213]
4PFX_A	6.69e-64	15	288	6	276	Thehighly conserved domain of unknown function 1792 has a distinct glycosyltransferase fold [Streptococcus parasanguinis FW213]
4PHS_A	9.45e-64	14	288	5	276	Selenomethioninesubstituted structure of domain of unknown function 1792 (DUF1792) [Streptococcus parasanguinis FW213]
5V4A_A	5.50e-62	23	288	8	271	ANew Glycosyltransferase (DUF1792) from Streptococcus sanguinis [Streptococcus sanguinis SK36],5V4A_B A New Glycosyltransferase (DUF1792) from Streptococcus sanguinis [Streptococcus sanguinis SK36]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AEU2	1.09e-60	23	288	417	679	Probable glycosyl transferase Gly OS=Streptococcus gordonii OX=1302 GN=gly PE=3 SV=2
A0A0H2URB1	9.89e-58	16	289	543	813	Glycosyltransferase GlyD OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004319_00332.