CAZyme Information: MGYG000004355_00547

Basic Information

• Species: CAG-302 sp900554615
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-302; CAG-302 sp900554615
• CAZyme ID: MGYG000004355_00547
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356	MGYG000004355_10|CGC1	40950.76	9.799

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004355	1353414	MAG	Israel	Asia

• Gene Location: Start: 21468; End: 22538 Strand: +

Full Sequence      

MEKDLSLEEKIGQMFMFGVNKNNIDGILDLIKNNKIGGVILYKQNYTSYEEMLSLIKRIR
EANASNKTPLLVAVDQEGGRVNRMPPEFKNLRSITYVSDLNKPSLIKKYSEIISKELSES
NINMNFAPVLDINNNSNNNVIKLRCFSNEEQKVSEYGKIYIKEMQSNNVIPVVKHFPGHG
CTKKDSHMFLPYINNYKEMLNKHMKPFEVAIKNNCDAIMVGHIIIPKLTGVFPASMSQKF
ISEYLRKRYNYDGLVITDDIRMKSVSILYRGVALKKAFTSESDIVLFKYRKGDEKIIEKV
VDMAKKGIIPEEKINESVSRILKIKEKYKVTDKIINKGCNIEEINKEIEKLNSNIK

Enzyme Prediction     

No EC number prediction in MGYG000004355_00547.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	63	285	1.2e-46	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	6.76e-70	5	333	1	320	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	6.82e-65	6	324	1	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	6.16e-41	36	263	26	254	beta-hexosaminidase; Provisional
PRK15098	PRK15098	6.93e-11	3	325	43	353	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APC40672.1	4.86e-88	5	354	54	409
CDI50326.1	2.18e-85	5	351	55	404
AFL99430.1	2.92e-84	5	354	65	417
AIQ35662.1	3.18e-84	4	349	58	406
AVP54061.1	2.18e-82	5	351	55	404

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	1.86e-51	3	327	9	339	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	2.99e-46	5	327	42	395	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.13e-45	5	327	16	369	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.59e-45	5	327	46	399	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
4ZM6_A	1.69e-45	4	338	6	350	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	1.64e-45	5	327	42	395	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	5.53e-40	29	327	57	382	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
A1SW90	1.85e-35	29	286	19	277	Beta-hexosaminidase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=nagZ PE=3 SV=1
C4LEY6	1.77e-34	29	267	19	255	Beta-hexosaminidase OS=Tolumonas auensis (strain DSM 9187 / TA4) OX=595494 GN=nagZ PE=3 SV=1
P44955	3.50e-33	28	286	18	277	Beta-hexosaminidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004355_00547.