CAZyme Information: MGYG000004377_00774

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000004377_00774
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
645		73218.05	9.588

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004377	2011786	MAG	Israel	Asia

• Gene Location: Start: 2645; End: 4582 Strand: +

Full Sequence      

MKHPEVAAAMRAHGICVVMPTYNNGATVGAVIDSLLDYCGDIIVVNDGCTDDTTGILAGY
GNAVTTVSYGRNRGKGYALKRGLAKAREAGFEYAVTIDSDGQHKALDIPAMVAAVIENPG
ALIIGARDLSKVDINGKSSFANKFSNFWFRVQTGIGLSDTQTGYRVYPLKQLHGLGLITS
RYEAELEMLVFAAWHGIRIVSVPIDVYYPPRNLRVTHFKPALDFTRISVLNTFLCAGALV
YGLPCRMVNGLRHRKPFAGDFRWFTHSGDVRRSTAVTLGKFFKSLYAAAFFVTWTMCVLR
PVTYLRFRFGNVGEESRLRYHKSLQYLSKFILRNFPDARTEILNPHGETFDRPAVIVCNH
QSHFDLPILMSLTPRLVFLTNEREWNNRYYGSLIRRAEFLPVTEGVDELLPKLADLRDRG
YSVVIFPEGTRSADDKVLRFHQGAFHIARELRMDVVPMVLHGVGHYHHKHDPWLRRGRMS
LSVLQRVPYDADDTATLRKTASRFRRLIMEELDRLADAKENTAYFRKFVRYKYAYTGWRN
VSEVKRILSHYGEYAGEIDSIPATTGSVALRNAGTGALAWLMALVNRRSEIYAYINEKEN
LELVERLADVPANLHFVHDVWDTHFSTLHFDRIYEADGCKLRRIK

Enzyme Prediction     

No EC number prediction in MGYG000004377_00774.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	16	142	2.2e-19	0.7647058823529411

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04179	DPM_DPG-synthase_like	1.02e-41	17	192	1	185	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
cd07989	LPLAT_AGPAT-like	2.52e-31	328	512	1	183	Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are such LPLATs as 1-acyl-sn-glycerol-3-phosphate acyltransferase (AGPAT, PlsC), Tafazzin (product of Barth syndrome gene), and similar proteins.
COG0204	PlsC	5.53e-30	285	534	1	249	1-acyl-sn-glycerol-3-phosphate acyltransferase [Lipid transport and metabolism].
smart00563	PlsC	1.07e-23	354	462	1	117	Phosphate acyltransferases. Function in phospholipid biosynthesis and have either glycerolphosphate, 1-acylglycerolphosphate, or 2-acylglycerolphosphoethanolamine acyltransferase activities. Tafazzin, the product of the gene mutated in patients with Barth syndrome, is a member of this family.
cd06442	DPM1_like	5.32e-23	17	204	1	197	DPM1_like represents putative enzymes similar to eukaryotic DPM1. Proteins similar to eukaryotic DPM1, including enzymes from bacteria and archaea; DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. This protein family belongs to Glycosyltransferase 2 superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB89979.1	1.38e-167	1	520	1	495
QUB89346.1	3.16e-166	1	520	1	495
AEA20238.1	1.73e-165	5	520	4	494
AXV50531.1	2.45e-165	5	520	4	494
QUB94105.1	2.54e-165	1	520	1	495

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KYM_A	1.21e-10	304	512	27	241	CrystalStructure of the 1-acyl-sn-glycerophosphate (LPA) acyltransferase, PlsC, from Thermotoga maritima [Thermotoga maritima MSB8],5KYM_B Crystal Structure of the 1-acyl-sn-glycerophosphate (LPA) acyltransferase, PlsC, from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3VA58	4.86e-14	15	208	6	220	UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminyltransferase OS=Methanococcus voltae OX=2188 GN=aglK PE=1 SV=1
D4GYG3	3.50e-12	15	223	7	211	Glycosyltransferase AglJ OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglJ PE=1 SV=1
Q42670	5.16e-11	257	462	45	238	1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Cocos nucifera OX=13894 PE=1 SV=1
O15120	1.73e-09	335	488	73	232	1-acyl-sn-glycerol-3-phosphate acyltransferase beta OS=Homo sapiens OX=9606 GN=AGPAT2 PE=1 SV=1
Q57964	3.12e-09	18	234	4	228	Uncharacterized protein MJ0544 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ0544 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000013	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004377_00774.