CAZyme Information: MGYG000004384_01258

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus
• CAZyme ID: MGYG000004384_01258
• CAZy Family: CBM79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
508		55770.64	4.2446

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004384	2222403	MAG	Israel	Asia

• Gene Location: Start: 7962; End: 9488 Strand: -

Full Sequence      

MLFGYWWGNAESIRIDSVICTYTRTREIPVDGTVSQNVGKSCSYETNSNTINIPTADFLP
EGAVPEAVTYNISTSGPFGKFTGAFGYNSSSGYYQSGDISVFTDSSSLSLTWFVPVQSKN
YVSDDGELVLGYWWSEQPNVTLDSVTVKYSLGGGNASMPTDKDVPKPTTPTVSTGDFRSA
DEIVSEINVGWNLGNTLDSYNTSKTGLATETGWGNPKTTKEMIQSVKNAGFNAIRIPITW
GEHMNGDTIDPEWLERAAEIVDYAYNEGMFVIINMHHDDAIWFEPDDSEYSADSAKLKAI
WGQIAARFADYGDRLLFEGMNEPRTIGSTDEWMGGTAAERAVINKYEQDFVDTVRKSGGN
NAERSLIITSYAASAETSAINDVVVPNNGNIIVSIHYYAPWQFSDGTSTVFDEAGKSELD
AKFAELKKKFADKGTPVIIGEFGCVNAAPENVRTDYYNYYIKSAMSQGIKCFIWDNGIST
GDQSFGIFNRSSLSWNEAILKAITDATK

Enzyme Prediction     

No EC number prediction in MGYG000004384_01258.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	210	477	4.2e-99	0.9891304347826086
CBM79	47	146	1.2e-23	0.9454545454545454

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.72e-65	198	477	4	269	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.98e-35	189	481	53	364	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam18522	DUF5620	3.98e-16	45	147	1	118	Domain of unknown function (DUF5620). This is a domain of unknown function predicted to be a carbohydrate binding module.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EWM54675.1	6.19e-238	1	508	174	683
CDE32105.1	8.32e-171	1	495	180	688
QPB75697.1	1.10e-169	177	505	31	359
CDE11886.1	7.77e-168	1	508	182	710
ERJ92483.1	9.14e-167	1	508	206	734

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PZ7_A	1.76e-96	171	495	1	324	GH5-4broad specificity endoglucanase from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]
6Q1I_A	7.11e-96	172	495	6	340	GH5-4broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum],6Q1I_B GH5-4 broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum]
6MQ4_A	1.76e-95	182	495	14	336	ChainA, cellulase [Acetivibrio cellulolyticus]
4W85_A	4.44e-92	182	502	7	334	Crystalstructure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with glucose [uncultured bacterium],4W85_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with glucose [uncultured bacterium],4W87_A Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with a xyloglucan oligosaccharide [uncultured bacterium],4W87_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with a xyloglucan oligosaccharide [uncultured bacterium],4W89_A Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with cellotriose [uncultured bacterium],4W89_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with cellotriose [uncultured bacterium]
3NDY_A	5.37e-92	180	496	12	329	Thestructure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDZ_A The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54937	5.83e-94	172	495	31	365	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
P23660	3.04e-93	161	508	5	364	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
P28623	2.87e-90	180	496	43	360	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
P28621	1.28e-87	171	495	32	361	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
P10477	1.21e-82	179	495	56	372	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.965117	0.032599	0.001831	0.000116	0.000065	0.000304

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004384_01258.