CAZyme Information: MGYG000004457_00882

Basic Information

• Species: CAG-485 sp900767075
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900767075
• CAZyme ID: MGYG000004457_00882
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
307		34263.95	8.7685

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004457	2747221	MAG	Israel	Asia

• Gene Location: Start: 7455; End: 8378 Strand: +

Full Sequence      

MRIFAATMRIRLHNLSSGIFMAAAIVILGACPARGDSYEEYIRQYADIAVAEQQSAGIPA
SITLAQGLLESAAGRSSLALKGNNHFGIKCHSEWRGDTLLRDDDAANECFRVYATAAESF
ADHSRFLLRKRYAPLFEHDVTDYAAWARGLRACGYATDPNYATRLITIIERYALYLYDSE
AGRHAEQTSAFIHDALRASHPVRRSRGLHYVIASPGDTYGSIAKELGMKKSKLLKYNDVR
KDREIKAWEEVYLEEKRPDAPDGIKQCMIGDGESIHSVAQRYGMRLDTVKALNPGAKDRP
GTMLKLR

Enzyme Prediction     

No EC number prediction in MGYG000004457_00882.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	46	174	7.8e-34	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF038016	sporang_Gsm	6.19e-35	39	178	161	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
COG1705	FlgJ	1.18e-34	2	189	11	201	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	1.21e-23	35	178	5	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	2.22e-23	46	174	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
TIGR02541	flagell_FlgJ	2.45e-19	32	173	142	294	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF12398.1	1.37e-80	19	307	10	299
QUT51213.1	8.02e-80	8	307	1	300
QUT71786.1	3.04e-77	11	293	7	284
QQA10134.1	3.04e-77	11	293	7	284
QCY57337.1	3.13e-77	8	307	1	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T1Q_A	3.96e-11	40	194	62	228	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	5.84e-11	54	174	17	148	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	6.91e-11	54	174	18	149	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
5DN5_A	1.47e-10	50	171	16	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.93e-10	50	171	16	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.54e-15	61	178	71	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	5.04e-11	32	171	154	304	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
P15931	1.31e-10	32	171	147	296	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
Q2G222	4.42e-10	40	180	322	474	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
P58231	1.11e-08	35	171	147	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000922	0.354344	0.644171	0.000210	0.000178	0.000149

TMHMM  Annotations     

start	end
12	34