CAZyme Information: MGYG000004499_01733

Basic Information

• Species: Victivallis sp900551245
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900551245
• CAZyme ID: MGYG000004499_01733
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
727	MGYG000004499_20|CGC1	81122.34	5.4572

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004499	4071424	MAG	Israel	Asia

• Gene Location: Start: 40304; End: 42487 Strand: -

Full Sequence      

MNFGHWITSPQLSRNCVTADPPSPAPLFRRAFECSGFTTGRVRLSGVGYHELYLNGRKVG
DRVLDPAVSCYEKRVRFVTFDITEYLHPGTNVVGVILGNGWYNPSTAEVWNFFKAPWRDC
VKFTIELEIDGRLVLGADESWKCTSGPILFDALRNGETYDARCEIDGWLGERYDDSGWLS
AVRIAGPGGMLDEQKMPPCKVLQTIPMTLHPAGRVYDAGQNLSGWARIAVQGEAGAEVKL
EYAERITEDGDLDTNFQDTFIKSGDFQTDRYILKGSGGVESWEPRFTYHGFRYVRVSVTG
AAEVRSIEARFVGTAFDSIGKITTSDETINQLQKMTRWSFRSNFVGIPTDCPHREKNGWT
GDAAIAADTGLYNFDVGSSYAEWLQLLADCQRRNGQLPGIAPTGGWGFDWGSGPAWDCAL
FSIPYEIYLHTGDDTAIRQNYPAMKRYLDFCGTMESDGILAFGLGDWASPEECGKSPSPA
LTSTGYYYMDAKRISSFARLLGEPEEEAKYRDLAERVRAAFNRKFHLGDGLYGDGSGKGE
LTALGCALYHDLVEPEFRQRTLDRLVALCREGGCRAYFGILGAKYVPRVLAENGHADLAC
RFFTQREFPGWAHWIDLGLTTLGEHWDGTASRNHIMFGDLGAWFFRYLGGFRHDPERPGC
RHLIVAPCPVVESCRAEYRGYVSEWEVKDGTMTIRLTVPPNSSAMLQLPGEERFELGSGI
YVRSAKL

Enzyme Prediction     

No EC number prediction in MGYG000004499_01733.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	213	708	7.7e-142	0.9841269841269841
CBM67	5	188	7.1e-33	0.9659090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.10e-109	317	648	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.63e-53	41	203	7	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.94e-26	215	312	9	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.87e-11	655	723	4	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	1.08e-04	424	533	348	469	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44981.1	2.60e-245	21	717	46	759
AVM44977.1	1.67e-212	25	699	17	694
QGQ94103.1	4.38e-206	3	716	124	848
AHF16194.1	7.65e-203	4	713	139	866
QNN24933.1	5.68e-197	23	709	350	1055

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	2.58e-130	25	719	176	910	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	3.40e-102	23	724	300	1012	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	8.04e-84	28	727	134	870	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	1.50e-101	23	724	300	1012	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	1.97e-100	41	708	201	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	1.77e-96	29	709	178	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	1.36e-75	41	704	187	874	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000023	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004499_01733.