CAZyme Information: MGYG000004499_03043

Basic Information

• Species: Victivallis sp900551245
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900551245
• CAZyme ID: MGYG000004499_03043
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
592		67490.66	5.3785

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004499	4071424	MAG	Israel	Asia

• Gene Location: Start: 9397; End: 11175 Strand: -

Full Sequence      

MLKTVNTPVGPVSVHIQSDDWNCELRNNNPLPGITLVTLELQRDTPAVLPQTTISWVIPS
IDIQYRWHPFAGTTGCWLPPDWNQSLLHSELAIGSPVVSLCSHRGANRMTFAFSDALNPV
DIRCGIRETDAWLVNEIHCFTTPSAPADSYCATLRIDTRSSVSGETALADVAAWWAAMPE
YRPCPVPDAARHPFYSTWYSFHQDLFDHELEEECKLAREYGMEGIIVDDGWQTEDNSRGY
AYCGDWEICLKRFPRMREHVDRVHALGMKYLLWYSLVWAGYESEAYRRFSGKFLYHNDRL
RAAALDPRFPEVREYLLNIYERALIEWDLDGFKFDFLDSFRFDGEDPAVAEGYAGRDYKL
LSRAVDRLLTDAMTRLRAIRPDILIEFRQRYIGPAMRKYGNIFRVGDCPCDVIANRTGIV
NIRRLSGDTAVHSDMLMWNYKEPVEVAALQLLNVLFAVPQISVRLRDIPESHRRMLKFYL
DFWREFRDVLLDGKLHARQPECNDTVVSAEKENRRVSVLYAAHSALHLAPQDGGTECIVN
ASGSVGFVLDLDREPVESTCFDAQGNVIRLDAIHAGLNQVSLPPAGMIQLSF

Enzyme Prediction     

No EC number prediction in MGYG000004499_03043.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	176	519	1.9e-32	0.5101744186046512

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	4.70e-62	195	485	6	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	1.36e-09	197	386	51	236	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd06592	GH31_NET37	8.13e-09	191	336	1	151	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG3345	GalA	1.56e-08	197	336	298	442	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14792	GH27	8.10e-06	195	437	5	217	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46708.1	3.64e-198	9	592	7	587
CQR57728.1	2.52e-182	19	590	18	587
QHW35515.1	4.73e-182	20	586	19	580
AIQ41463.1	8.10e-176	2	590	1	590
AZS17022.1	8.52e-176	19	590	15	583

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YFN_A	3.42e-07	196	386	334	516	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]
6PHU_A	1.37e-06	107	335	270	492	SpAgawild type apo structure [Streptococcus pneumoniae TIGR4],6PHV_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4]
6PHW_A	5.42e-06	107	335	270	492	ChainA, Alpha-galactosidase [Streptococcus pneumoniae TIGR4],6PHX_A SpAga D472N structure in complex with raffinose [Streptococcus pneumoniae TIGR4],6PHY_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4],6PI0_A AgaD472N-Linear Blood group B type 2 trisaccharide complex structure [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G4T4R7	2.05e-06	196	386	334	516	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000013	0.000037	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004499_03043.