CAZyme Information: MGYG000004513_02263

Basic Information

• Species: Victivallis sp900550905
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900550905
• CAZyme ID: MGYG000004513_02263
• CAZy Family: GH167
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1153		130374.06	8.7758

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004513	4294613	MAG	Israel	Asia

• Gene Location: Start: 10799; End: 14260 Strand: -

Full Sequence      

MKLPLLIFAVICAALTGRTQGIEFRNADFREVDTENFPVAWRLGGNRGDMDFSVTAGDGV
LKIINRTPRRKNQYLALVPKQLHGIVPGDQLLVQLEAKGTPNLDAGIILGNWNRRLWLRR
IEMRKFTGFHLKFKVEEQDIAEGTLRFYLIVESPGELQIRNLTLTRKERGPQATVIPAEE
FQKHGLLPVRKSSSVPSEPAAFFTLPLDSEHFFSDDGKPAAADGFTGKVGCTFTGTSFRF
RFDVLDPRQVVRRGNEMYTGDGVQLQLDPLFAPHAGAKVTDLELGAAPGNPRAYCWSMGR
ELSAEEAEVVTTAIPGGYRLELELKASLLKDFRWDELRGFSFNFLINDRNDEQGARRVAF
FAPGIHLGKSAKYNALALRDDGIPSAVLRLEPVREARIRGELYLLGCTGIRPLPVVLRFT
DSGGLVRELTVATMPPIPAGGIGRAEFAVNIPVELADGPLRLEAVVEGKVLGRRILSGEG
RRSPEQKLQEQRKVFQTLQARSRNPKSFAALICTLFERGLTLAEADLRTSGSAGAVRYHR
TRGELQLDELARLAVHWKEQLEQPQPFSMRNDAGFFIGYGHFADAIDDIPLFEKIGANFV
QTEIGPARTFPRREGEFDPTYYQKYVARPLELGRKHNVKICVLLSPHVIPDWWWKNHEAD
LAPKPRHQMEYFYDWNAPEVRKLLKAHIEAVCRLLAEDPNREALHSICLSNEPKSENPNL
NRVETRRAFFAALKKKFVTIAAFNEISGKNYPDWETLEQEQGSSPALHYAFERWKQCHFA
RSHRWMYEIVKKYLPDVPVHVKLPAPHSSRQPKWGTDIALFSDFSDLNGNDSGSSYRKDT
LYLANWINFQRTYDMQRSFKNVPVMNTENHIIADGDFTPVPYEHVYCATFLEALYGARGI
VTWVWNRCSYQQHLRDIWLDASIYYRPLNIWAQAKATSDLRRLAAEVEAFAEAPFPVALL
HSHSSFLQNGEAYVRKQEEVYAALACCGDKVGFLREDRLAERNFSAVRRLFLTSTSHLSE
EAIAALQEFTAAGGKLYVCGTAPRWNSYGKPLDKPLPPYTVIPDTRLTAEEMQQSFVYPE
APVFAGAVSGLVQRSVPFRGGKWLLSLVNYNDTPVEVRLHLPQKARVQDLISGRTVTERF
SLKPLRPMLLLVR

Enzyme Prediction     

No EC number prediction in MGYG000004513_02263.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH167	567	1151	1.2e-98	0.8396094839609484

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	6.88e-10	235	374	38	184	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd00241	DOMON_like	3.02e-06	212	360	5	158	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
cd09619	CBM9_like_4	2.78e-04	206	356	17	166	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46829.1	7.24e-123	38	1150	35	1178
AVM43323.1	2.36e-108	53	1150	215	1354
AVM43886.1	2.44e-93	318	1153	99	999
QGQ94885.1	1.31e-57	569	1112	1054	1601
AHF94331.1	1.40e-57	14	1150	179	1386

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000252	0.998993	0.000269	0.000151	0.000145	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004513_02263.