CAZyme Information: MGYG000004588_00510

Basic Information

• Species: Prevotella sp900317685
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900317685
• CAZyme ID: MGYG000004588_00510
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1001	MGYG000004588_6|CGC2	113164.44	6.8634

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004588	3452051	MAG	France	Europe

• Gene Location: Start: 50682; End: 53687 Strand: +

Full Sequence      

MRQLFITLFAAMVCSYAQARQTFNFNSDWRIDKAKKTITLPHAWNEDDAFRVSSYDMSQG
IVWYRKTFSLDALHLKPGQHVLIEFEGAHIAAEVFLNGKRVGLHENGVMAFGYDLTPYLK
KGKNLIEVRTDNQMDYKEQATGTPLQWNSRAFFANYGGITKNVWLHVTDPVYQTLPLMSG
LGTTGVYVYGRDYSILEHTATICVESQVKNDSDQPVRRCIDVTVKERNGAVLCHFTGGET
LIPAHTTATLRAEHRQSGLHFWSWGYGYLYDVETRLASADGQKEDCVVTTTGFRKTEFKR
GMVYLNDRVIMMHGYAQRSTNEWPGVGASVPAWLSDYSNRLLVKSGGNIVRWMHVTPSKQ
DIESCDRVGLIQAMPAGDAERDAQGRQWVQRLELMRDAIIYNRNNPSILFYECGNQRITG
QHMIEMKNLRNAYDPNGGRAIGCREMLDQPEAEYGGEMLYVNKSDTKPMWMMEYCRDEAN
RLYWNSWSYPYHKEGDGPLYRGESAAAYNHNNDEFVAELVRRWYDYYQERPGTGTKVNAG
GAKIIFSDSQTHGRSNENYRTSGVVDPMRIAKDAYYAHQVMWDGWVDDLKPHTYIVGHWQ
YDDGFAVPTVYVVSNGDSVVLRQNGHVIHPDSHDYHFLWTFKNVKHESDRLEAIAYDGKG
QVVSHDEKVTPGRPDHLKLTTIQNPTGWKADGADVALVQVEVVDKDGHRCPLDDRMVKWS
LNGQAEWRGGIAENRPYGQVVSRLSLMAKNLDDVPTAQRDRIFKHINHVLCDTLPVECGV
NRVMLRSLPKAGKVTLTATAEGLPDAKVELSTIPVKVESGLSAFRPSDGLSCDLSRGETP
STPSFVPTKENVYITDVVAGSNQKDATLSFDRYENTAWSSIANRDSAWITYTLAEPAKIS
EACLKMGGFRNTSYPIAIYAGDVEVWRGNTPKSLSFVRLPLKDAPASLTYTIRLVGDTSL
GDAFGAVKEMDNRNNEKQSKERKTLKIIEAEWIRNIISYEH

Enzyme Prediction     

EC	3.2.1.31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	16	570	5.4e-64	0.6223404255319149

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	5.37e-27	19	496	24	495	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam18565	Glyco_hydro2_C5	1.15e-17	677	809	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
pfam02837	Glyco_hydro_2_N	3.83e-16	15	165	26	165	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
PRK10340	ebgA	3.56e-15	64	435	113	468	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	1.08e-12	18	416	8	417	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL41159.1	0.0	5	996	10	986
QIU94574.1	0.0	4	996	7	986
ALJ49030.1	0.0	4	996	7	986
QRQ55837.1	0.0	4	996	7	986
SCV08447.1	0.0	4	996	7	986

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPD_A	1.76e-128	20	851	35	846	Thestructure of a beta-glucuronidase from glycoside hydrolase family 2 [Formosa agariphila KMM 3901]
5T98_A	6.24e-42	17	728	22	763	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
7CWD_A	1.67e-38	24	729	5	746	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4CUC_A	3.96e-32	36	812	44	844	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA. [Streptococcus pneumoniae TIGR4]
4CU6_A	5.22e-32	36	812	44	844	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU7_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU8_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KN75	7.87e-128	20	851	26	837	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
A7LXS9	1.70e-41	15	811	37	847	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	3.99e-31	4	842	31	852	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	1.23e-25	3	723	28	771	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	7.12e-25	20	729	3	695	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002513	0.857783	0.138610	0.000511	0.000297	0.000270

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004588_00510.