CAZyme Information: MGYG000004673_00257

Basic Information

• Species: Veillonella sp900552445
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; Veillonella; Veillonella sp900552445
• CAZyme ID: MGYG000004673_00257
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
571	MGYG000004673_1|CGC1	64510.94	9.1174

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004673	2029595	MAG	China	Asia

• Gene Location: Start: 258978; End: 260693 Strand: -

Full Sequence      

MIRKSTIFKSLTALVMSALSTTAVQAEVLVPLEQFLATTTRHYEANQYKTAYTVYVPQTE
LQGNTVVLNPAAVGEPVKLPITKQNGITYVDIESDPAMLGVSYTKTNGQVTLGPAPQAST
VKAPYTLQTPLSWAFDPWPTQGTPYQAKLNVSGDNIISPSWFKLHSLGLEASPNVNIDYV
NDYKSKGYHVWPLITNRFDPDFTSGILADQSVWKKYAHNLVQYAYIYGFDGYNFDFENID
YADRDRLTTFVAYLSNHLHQYNIKTSIDVTGYSDSPEWSLVYNRSALANSVDYVVLMAYD
ETWAKSTTAGPVASYPWVRNHTERMLSEVPSHKLVLGVPFYMRLWHDTNGYAKGETLAMK
NTGTYFANHKDKMTWDDRLKLYYLSIPTSSGSDRIWFEDNTSLGLKLDLVKELKLGGFAA
WRKGFEDESTIAMIQGKDLGRGIPKSATEVVPEPVVEETKPLTKLEQYKLRLEEKEKAKA
AKAEAKRKAKEEKEAAKRKAKEEAEQAKAEKKRKAEEAKAEKKRLDEESKANKERDTQEV
KERNASYKSHSSVQNTTTKNELTKSIQVVKR

Enzyme Prediction     

No EC number prediction in MGYG000004673_00257.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	185	429	1.2e-36	0.7702702702702703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	3.27e-59	155	429	27	308	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	1.04e-41	5	438	13	422	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
smart00636	Glyco_18	3.38e-24	135	421	6	329	Glyco_18 domain.
pfam00704	Glyco_hydro_18	9.94e-21	202	421	79	302	Glycosyl hydrolases family 18.
cd02876	GH18_SI-CLP	3.84e-18	137	416	11	301	Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome. SI-CLP has a glycosyl hydrolase family 18 (GH18) domain but lacks a chitin-binding domain. The catalytic amino acids of the GH18 domain are not conserved in SI-CLP, similar to the chitolectins YKL-39, YKL-40, and YM1/2. Human SI-CLP is sorted to late endosomes and secretory lysosomes in alternatively activated macrophages.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEG93546.1	0.0	1	571	1	560
BBU34423.1	0.0	1	571	1	560
BBU36194.1	0.0	1	484	1	484
CAB1275696.1	0.0	1	571	1	560
SNU97803.1	0.0	1	571	1	560

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	1.64e-16	193	422	76	307	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4WIW_A	9.91e-16	230	430	114	336	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]
4S3K_A	3.30e-15	198	426	182	415	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4S3J_A	4.25e-14	193	424	172	411	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
3AQU_A	1.13e-09	214	432	94	336	Crystalstructure of a class V chitinase from Arabidopsis thaliana [Arabidopsis thaliana],3AQU_B Crystal structure of a class V chitinase from Arabidopsis thaliana [Arabidopsis thaliana],3AQU_C Crystal structure of a class V chitinase from Arabidopsis thaliana [Arabidopsis thaliana],3AQU_D Crystal structure of a class V chitinase from Arabidopsis thaliana [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32258	1.38e-21	155	429	53	334	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
O31682	4.42e-18	155	347	27	214	Putative glycosylase YkvQ OS=Bacillus subtilis (strain 168) OX=224308 GN=ykvQ PE=3 SV=1
O05495	2.95e-16	193	422	168	399	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P37531	2.37e-15	169	424	147	409	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
P0DPJ9	4.14e-14	193	424	171	410	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000476	0.998453	0.000429	0.000251	0.000191	0.000164

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004673_00257.