CAZyme Information: MGYG000004688_00751

Basic Information

• Species: CAG-873 sp900550395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900550395
• CAZyme ID: MGYG000004688_00751
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
458	MGYG000004688_8|CGC2	51399.64	7.6384

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004688	2658373	MAG	Spain	Europe

• Gene Location: Start: 81610; End: 82986 Strand: +

Full Sequence      

MSILREILFGAITAAAAAGIGGCGGAQTEAPRRLPDTLRVATLYSPTTYFIYRDEPMGYD
YTLAADFARAKGMVLDLRVARSMTEAVALLDSGRIDLLACGVPVTSQMRGKVVACGPELL
TTQVLVQPKIKGEPAITDVTQLPGREVYVERGSKYEQRLRHLNDELGGGIDIRSVDSDSL
IDEDLMQMVSDGRIPLTVVNRDVALLNATYYPDLDVSLEVSFPQRAAWGVAPQREWLADS
IDAWMATADARRDNADLLKRYFEISKGRASDVSFDFSKGYISRFDNLFRTYAERIGWDWR
LLAAQGWAESRFRPTARSWVGARGLMQIMPRTARGYRTPVSQLNNPETSIRVATRLLDDL
DRQLKPYVPNDRERLKFVIGSYNVGIAHVLDAMRLSEKYGMNPQVWDDNVARALLMKSKP
EYYNDPVVRYGYCRGSEPVGYVRQIMAFYDSAKREIQA

Enzyme Prediction     

No EC number prediction in MGYG000004688_00751.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	294	454	4e-25	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10859	PRK10859	2.47e-86	37	451	44	449	membrane-bound lytic murein transglycosylase MltF.
cd13403	MLTF-like	1.23e-75	288	454	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	7.10e-68	38	451	25	430	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
cd01009	PBP2_YfhD_N	1.90e-58	37	263	2	223	The solute binding domain of YfhD proteins, a member of the type 2 periplasmic binding fold protein superfamily. This subfamily includes the solute binding domain YfhD_N. These domains are found in the YfhD proteins that are predicted to function as lytic transglycosylases that cleave the glycosidic bond between N-acetylmuramic acid and N-acetylglucosamin in peptidoglycan, while the YfhD_N domain might act as an auxiliary or regulatory subunit. In addition to periplasmic solute binding domain, they have an SLT domain, typically found in soluble lytic transglycosylases, and a C-terminal low complexity domain. The YfhD proteins might have been recruited to create localized cell wall openings required for transport of large substrates such as DNA. They belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.
pfam00497	SBP_bac_3	1.22e-21	38	262	1	223	Bacterial extracellular solute-binding proteins, family 3.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB37997.1	8.70e-176	22	457	28	461
QQR08735.1	8.70e-176	22	457	28	461
ANU63911.1	8.70e-176	22	457	28	461
QCD43102.1	1.25e-165	33	453	39	459
QCD39868.1	8.81e-161	34	453	41	459

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OYV_A	5.31e-43	24	450	1	426	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OWD_A	1.02e-42	24	450	1	426	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
4OZ9_A	3.31e-42	38	450	13	419	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
5AA4_B	2.58e-41	38	450	6	412	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	2.58e-41	38	450	6	412	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4SNZ5	4.82e-51	38	451	49	452	Membrane-bound lytic murein transglycosylase F OS=Aeromonas salmonicida (strain A449) OX=382245 GN=mltF PE=3 SV=1
A0KJ50	9.34e-51	38	451	49	452	Membrane-bound lytic murein transglycosylase F OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=mltF PE=3 SV=1
A4XXV1	1.56e-49	38	450	45	451	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas mendocina (strain ymp) OX=399739 GN=mltF PE=3 SV=1
A8ZWR8	1.59e-46	40	455	45	451	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
Q3KHL5	2.91e-46	38	450	43	449	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000003	1.000044	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004688_00751.