CAZyme Information: MGYG000004711_00115

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter
• CAZyme ID: MGYG000004711_00115
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
212		24661.97	8.9198

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004711	3563826	MAG	Spain	Europe

• Gene Location: Start: 129651; End: 130289 Strand: +

Full Sequence      

MITIKQLKNILKWAIDTDIEKYLPWFNTFFLRYEINTPERKAAFIAQIGHESNYLKCVEE
NLNYSVSGLRQVFGKYFPTDEIANRYARKPEQIANLVYANRMGNGKVESGDGWRFRGRGL
LQFTGRENYNRIGKFIGVDFITYPEELTTPKYAVQSACCWWQNKGLNNLSDSTTDEAFKQ
ITRTINGGDNGFYNRLELWERAKNVLVLNVEP

Enzyme Prediction     

No EC number prediction in MGYG000004711_00115.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	36	188	6.3e-32	0.6103896103896104

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3179	COG3179	1.83e-68	32	207	33	205	Predicted chitinase [General function prediction only].
pfam00182	Glyco_hydro_19	9.84e-06	34	212	45	226	Chitinase class I.
cd00325	chitinase_GH19	6.94e-04	42	188	50	189	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO41584.1	4.83e-64	7	206	8	205
AWB67504.1	1.70e-61	2	209	5	210
ALU42132.1	5.01e-61	7	209	8	208
UAA37909.1	5.40e-60	2	206	4	206
QPB83444.1	8.67e-60	7	209	10	210

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OK7_A	5.14e-34	21	206	34	222	ChainA, Endolysin [Salmonella phage SPN1S],4OK7_B Chain B, Endolysin [Salmonella phage SPN1S],4OK7_C Chain C, Endolysin [Salmonella phage SPN1S]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44187	1.24e-38	40	199	39	191	Glycosyl hydrolase family 19 domain-containing protein HI_1415 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1415 PE=3 SV=1
O64203	4.38e-06	23	188	200	343	Endolysin A OS=Mycobacterium phage D29 OX=28369 GN=10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004711_00115.