CAZyme Information: MGYG000004734_00782

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; HGM11417
• CAZyme ID: MGYG000004734_00782
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
466	MGYG000004734_3|CGC2	53006.77	5.1012

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004734	2053744	MAG	China	Asia

• Gene Location: Start: 170995; End: 172395 Strand: +

Full Sequence      

MVITDNRANEVKIAYIGGGSRGWAWGLMSDLAEEKSLSGEIYLYDIDAEAARHNEIIGNK
IPEYYPDCARWKYRQVPTLEDALKNADFVIVSILPGTFEEMGYDLELPQKYGILQPVGDS
TGLGGIVRSLRTIPMFREIALAVEKFCPEAYVINYTNPMTVCIKTLYEVFPNIRAVGCCH
EVFGTQKLLAQAYEKYTGTEIDYEEVEVEVSGVNHFTWLTRAFYKNEDLMPYYRRLAAEY
AATGYEKGKDDNWMNSVFDCAHRVKFELFNRFGSIAAAGDRHLAEFCPRQWFLLNDGQIR
DWKFSTTSVEWRKKDLTERLKKSEELMSGVRPFEIKETGEVGVRMIKSLCGIDAFRTNVN
MVNKGQLPCAKKGAVVETNAYFSGIGMEPIVSVSELPPAVTAMVNRVIDIQEMVVAAGLR
GDRRLAFQAFCLDPMNTLTLEQSETLFNEMIDRTKKYLPKSFWEKI

Enzyme Prediction     

No EC number prediction in MGYG000004734_00782.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	12	191	9.5e-53	0.9832402234636871

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	2.72e-134	11	451	1	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	2.41e-93	11	460	4	438	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
PRK15076	PRK15076	3.01e-73	11	459	2	428	alpha-galactosidase; Provisional
pfam02056	Glyco_hydro_4	3.76e-55	12	192	1	180	Family 4 glycosyl hydrolase.
cd05197	GH4_glycoside_hydrolases	1.15e-42	11	452	1	424	Glycoside Hydrases Family 4. Glycoside hydrolases cleave glycosidic bonds to release smaller sugars from oligo- or polysaccharides. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by GH4 glycoside hydrolases. Other organisms (such as archaea and Thermotoga maritima) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. GH4 family members include 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidases, alpha-glucosidases/alpha-glucuronidases (only from Thermotoga), and alpha-galactosidases. They require two cofactors, NAD+ and a divalent metal (Mn2+, Ni2+, Mg2+), for activity. Some also require reducing conditions. GH4 glycoside hydrolases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEH67112.1	5.22e-177	5	462	5	462
ADL69889.1	5.24e-175	1	458	1	458
ADZ85649.1	1.39e-174	5	462	5	462
AFK85236.1	4.26e-174	1	458	1	458
ADZ82340.1	1.50e-171	1	459	1	459

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	7.77e-134	9	451	4	436	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
5C3M_A	3.34e-24	10	462	4	438	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	8.46e-24	4	462	1	441	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
1OBB_A	5.88e-18	10	451	3	465	alpha-glucosidaseA, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8],1OBB_B alpha-glucosidase A, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8]
7BR4_A	4.48e-16	11	231	13	238	ChainA, Alpha-glucosidase, putative [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I3VRU1	8.52e-175	1	458	1	458	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
D3T426	1.40e-160	1	458	1	450	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
A9KTB9	3.26e-152	1	462	1	464	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
P39130	3.87e-138	9	451	8	440	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
O34645	1.21e-42	12	446	3	414	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004734_00782.