CAZyme Information: MGYG000004752_01479

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia
• CAZyme ID: MGYG000004752_01479
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517		56310.28	4.1796

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004752	1894066	MAG	China	Asia

• Gene Location: Start: 8; End: 1561 Strand: -

Full Sequence      

MRQDDDLDIGGDRATAERGMLIPVIIVAVLLALVLAALVFVNKKDKKQDTPASFEDAVIL
DTEEEKSTAWKGGGAESLGGAGDAEDPQSGNGGHMSSASGADVDVAQLLLAGDVAETERM
TFGVDVAKYQGTIDWREVAASGVEFAMVRVGYRTQKTGEICPDTNAKYNMQEAQVNGIKV
GAYFFSTAVTEEEAKEEADWVADYISQYQITYPVAYNCEGFEDSQSRQYNLTQKERSDLA
FAFLNRVYERGYTPMFYASRNELEADAKWDTSRISKSYKIWMAWYPTYIDPKELGPDNEY
ARDCAMWQYTNMGSVPGISEPVDVNVAYFGYEGTADAKSDAAPEQVTADAEALMNFSEIN
ETVTAKEKTNLRDIPSQGADSKVLAALSNGETVTRTGISSSGWSRLEYNGQICYAVSSYL
TTDLGYQAAGTLGQEGTGSGDGLKTKFTDTNDTVTAKIEVNLRSLPSVTNPDAAVVAVLR
NGETVIRTGINTDHGWSRVEYNGQSLYCVTSYLTVVQ

Enzyme Prediction     

No EC number prediction in MGYG000004752_01479.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	124	318	2.3e-42	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	2.26e-62	122	328	2	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	9.97e-30	123	327	2	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	7.06e-25	124	318	1	180	Glycosyl hydrolases family 25.
cd06413	GH25_muramidase_1	2.69e-21	123	328	5	190	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06524	GH25_YegX-like	5.56e-19	122	326	1	191	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK89713.1	3.96e-180	17	515	4	483
ACR77025.1	7.96e-180	25	515	12	483
CBK93417.1	3.21e-179	17	515	4	483
AOZ95022.1	3.09e-168	84	517	82	510
CBK74296.1	1.29e-162	42	517	54	522

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAG_A	2.91e-06	123	328	18	207	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
19	41